KEGG   Gekko japonicus: 107110949
Entry
107110949         CDS       T04299                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04068  FoxO signaling pathway
gja04114  Oocyte meiosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04370  VEGF signaling pathway
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107110949 (MAPK12)
   04370 VEGF signaling pathway
    107110949 (MAPK12)
   04068 FoxO signaling pathway
    107110949 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107110949 (MAPK12)
   04218 Cellular senescence
    107110949 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107110949 (MAPK12)
   04621 NOD-like receptor signaling pathway
    107110949 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    107110949 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    107110949 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107110949 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    107110949 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107110949 (MAPK12)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107110949 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107110949 (MAPK12)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107110949 (MAPK12)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107110949 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 107110949
NCBI-ProteinID: XP_015267292
LinkDB
Position
Un
AA seq 361 aa
MASPKKGFYRQELTKTLWEVKERYRDLQPVGSGAYGSVCSAIDRKSGTKVAIKKLYRPFQ
SELFAKRAYRELRLLKHMKHENVIGLLDVFTPDVSLEKFNDFYLVMPFMGTDLSKIMKHE
KLSEDRIQFLVYQMLKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHTDSEMT
GYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGRPLFKGNDHLDQLTEIMKVTG
TPTQDFVQKLQSQDAKNYIKSLPKVQKKDFAAILKYANPLAVNLLEKMLVLDAENRITAA
EALAHPYFEAIHDPEEEPEAEKYDDTYDNMDLPLDEWKCITYKEIMNFKPPQLPESKETA
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcttcccctaagaaaggcttctaccggcaggagctgacgaagaccctctgggaagtg
aaagagcgctatcgggatttgcagccggtgggatccggagcctacggctcggtgtgctca
gctattgaccggaaaagtggaaccaaagtggccatcaaaaagttgtaccgcccatttcaa
tctgaactctttgccaaacgagcctaccgggaattgcgactcctgaaacacatgaagcat
gaaaatgtaattggactactagatgttttcactccagatgtgtcacttgagaaatttaac
gatttctacctcgtcatgccatttatgggaacagatctgagtaaaataatgaaacatgag
aagctatctgaagataggatccagttcctggtctatcagatgttaaagggcctaaagtat
atccattcatcaggcataattcatagggacctaaaacctggaaacctagcagtaaatgaa
gactgtgaactgaagattttggactttggactagcaagacatacagacagtgaaatgact
ggatacgtggttaccaggtggtacagagccccagaagttatactaaattggatgcattat
actcagacagttgacatctggtcagtgggttgtataatggctgagatgataacaggaagg
ccgctcttcaaaggcaatgatcatctggaccagctcacagaaattatgaaagttacagga
acaccaactcaagattttgttcagaaacttcaaagccaagatgcaaaaaactatatcaaa
agcctcccaaaagtgcagaagaaagattttgctgccatcttgaagtatgcaaatccctta
gcagtaaaccttttggagaagatgctggtgttagatgcagaaaacagaataacagccgca
gaagctttggcgcatccttattttgaagccatccatgaccctgaagaggaacctgaagca
gagaaatatgatgatacttatgacaacatggatctgcccctggatgaatggaaatgcatt
acatataaggaaataatgaactttaagcctccacagttgcctgaatcaaaagaaacagcg
gtataa

KEGG   Gekko japonicus: 107110955
Entry
107110955         CDS       T04299                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04068  FoxO signaling pathway
gja04114  Oocyte meiosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04370  VEGF signaling pathway
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107110955 (MAPK11)
   04370 VEGF signaling pathway
    107110955 (MAPK11)
   04068 FoxO signaling pathway
    107110955 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107110955 (MAPK11)
   04218 Cellular senescence
    107110955 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107110955 (MAPK11)
   04621 NOD-like receptor signaling pathway
    107110955 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    107110955 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    107110955 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107110955 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    107110955 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107110955 (MAPK11)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107110955 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107110955 (MAPK11)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107110955 (MAPK11)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107110955 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 107110955
NCBI-ProteinID: XP_015267300
LinkDB
Position
Un
AA seq 361 aa
MSERGGFYKQDLNKTVWEVPQRYQHLTPVGSGAYGSVCSAYDTKTRQKVAVKKLSRPFQS
LIHARRTYRELRLLKHMKHENVIGLLDVFTPAASIENFNEVYLVTNLMGADLNNIVKCQK
LTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQTDDEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGT
PSSELLKKISSEHARKYIESLPYMPPQDLKAVFRGANPLAVDLLEKMLILDSDKRITASE
ALTHPYFVQYHDPDDEPEAELYDESIENKERVIDEWKELTYEEVISFKPPDLKLDSLEIE
Q
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtctgagcgaggcggcttctataagcaggacttgaacaagaccgtgtgggaggtgccc
cagcgctaccagcacctgaccccggtgggctcgggtgcctacggctcggtgtgttcagca
tatgataccaaaacaagacagaaggtggcagtcaaaaagctttcgagacctttccaatcc
cttatccatgccagaaggacttaccgggagcttagattactcaagcatatgaaacatgaa
aatgttataggattactagatgtttttacacctgcagcatcaatagaaaattttaatgaa
gtgtatcttgtcacaaatttaatgggtgctgacctgaacaatattgtgaagtgccagaaa
ttgacagatgaccatatacagtttcttatataccagttacttcgaggacttaagtatatt
cattcagctgggatcattcaccgggacttgaagcccagtaacctagctgtaaatgaagac
tgtgaattaaggattttagactttggtttagcccggcagactgatgatgagatgacaggc
tacgtggcaacacgatggtacagagccccggaaatcatgttgaattggatgcattacaat
cagacagtggacatttggtcagttggatgcatcatggctgagttgctgaaaggcaaggcc
cttttcccaggaaatgactatattgaccagctaaaacgaattatggaagttgttggtaca
cccagttctgaacttctcaagaagatctcatcagaacatgccagaaaatacatagaatct
ctaccatatatgcctccacaagatttgaaggcagtatttcgtggtgctaatccattagct
gtggatctccttgagaaaatgcttatcctggacagtgataaaagaataacagcctcggaa
gcacttacacatccatacttcgtacagtatcatgatcctgacgatgaaccagaagcagag
ctgtatgatgagtcaatagagaataaggaacgggttatagatgaatggaaagaacttaca
tatgaagaagtcatcagcttcaaacctcctgatttaaagttggatagccttgaaattgaa
cagtga

KEGG   Gekko japonicus: 107110975
Entry
107110975         CDS       T04299                                 

Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04068  FoxO signaling pathway
gja04114  Oocyte meiosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04370  VEGF signaling pathway
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107110975
   04370 VEGF signaling pathway
    107110975
   04068 FoxO signaling pathway
    107110975
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107110975
   04218 Cellular senescence
    107110975
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107110975
   04621 NOD-like receptor signaling pathway
    107110975
   04622 RIG-I-like receptor signaling pathway
    107110975
   04625 C-type lectin receptor signaling pathway
    107110975
  09152 Endocrine system
   04912 GnRH signaling pathway
    107110975
   04914 Progesterone-mediated oocyte maturation
    107110975
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107110975
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107110975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107110975
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107110975
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107110975
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 107110975
NCBI-ProteinID: XP_015267325
LinkDB
Position
Un
AA seq 360 aa
MTQERPKFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCSAFDTKTAQRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGPELLKKISSESARNYIQSLSYMPKMNFENVFIGANPLAVDLLEKMLVLDTDKRITAA
EALAHAYFAQYHDPDDEPVADPYDQSFESRELDIEEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgacccaggagcggcccaagttctatcggcaagaactgaacaagacggtctgggaggtg
cctgagcgataccagaacctctcgccggtgggctctggggcttacggctctgtctgctct
gcctttgatactaaaactgcccagcgagtggctgtgaagaaattgtccagaccatttcag
tccatcatacatgccaaaaggacctaccgtgaattgcgtctgcttaaacatatgaaacat
gaaaatgttattggacttctggatgtatttacacctgcaaagtcattagaggaattcaat
gatgtgtaccttgtaacccatcttatgggagcagatctgaacaatattgtgaaatgtcag
aagctcacagatgatcatgtacagtttcttatctatcaaattcttcgtggtttgaagtat
atccattcagctgacattatacacagagatttaaaacctagtaacctagctgtgaacgag
gactgtgaactaaagattctggattttgggttggctcgacatacagatgatgagatgacg
gggtatgtagcaaccaggtggtacagagctcctgagatcatgctgaactggatgcattac
aatcaaacagttgatatttggtcagttggatgtattatggctgagctgttgactggaaga
acactgttccctggtacggaccatattgatcagttgaagctcattttgagactcgttgga
accccaggccctgagcttttgaagaaaatctcttcagagtctgcaagaaactacatacag
tccttatcttacatgccgaagatgaattttgaaaatgtatttattggtgccaatccactg
gccgtagacttgctggagaagatgctggtgctggacacagacaaacgaatcactgctgct
gaagcgcttgcccatgcctattttgctcagtatcatgaccctgatgatgagccagttgca
gatccttatgaccagtcttttgaaagcagagaacttgatattgaggaatggaaaagcctg
acatatgatgaagtaattagctttgtgccaccaccgcttgaccaagaagagatggagtcc
tga

KEGG   Gekko japonicus: 107119112
Entry
107119112         CDS       T04299                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04068  FoxO signaling pathway
gja04114  Oocyte meiosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04370  VEGF signaling pathway
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107119112 (MAPK13)
   04370 VEGF signaling pathway
    107119112 (MAPK13)
   04068 FoxO signaling pathway
    107119112 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107119112 (MAPK13)
   04218 Cellular senescence
    107119112 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107119112 (MAPK13)
   04621 NOD-like receptor signaling pathway
    107119112 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    107119112 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    107119112 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107119112 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    107119112 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107119112 (MAPK13)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107119112 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107119112 (MAPK13)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107119112 (MAPK13)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107119112 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo DUF4023
Other DBs
NCBI-GeneID: 107119112
NCBI-ProteinID: XP_015277041
LinkDB
Position
Un
AA seq 259 aa
MPYMQTDLQKIMGHQFSDEKIQYLIYQVLKGLKYIHSAGIIHRDLKPGNLAVNEDCELKI
LDFGLARHADSEMTGYVVTRWYRAPEVILNWMHYNQNVDVWSVGCIMAEMLTGKTLFKGK
DYLDQLTQILKVTGSPSEEFVQKLEDKAAKSYIQTLPKIQKMDLSLLFPRASPLAVDLLD
KMLQLDVERRPTATQALAHPYFDRFRDIEEETEAQHSYDDSLEGEKLTINEWKRHTFSEI
LSFSPIVRKDSKRRSGMTL
NT seq 780 nt   +upstreamnt  +downstreamnt
atgccttacatgcaaaccgatttacaaaagattatgggacatcaattcagtgatgaaaag
atccagtatctaatctaccaggtgctgaaagggttgaagtatattcattctgctggaatc
attcacagggacctgaaacctggcaatttggcagtgaatgaagactgtgaactaaagatc
ttggacttcggattggcaaggcatgctgactcagaaatgacaggctatgtggtgactcgt
tggtaccgagcgcctgaagtgattcttaattggatgcattacaaccagaatgtggatgtc
tggtctgttggctgtatcatggcagaaatgctgactggaaaaactctgtttaagggcaaa
gactatctagatcagctgactcagatcctgaaggtgacaggaagccctagtgaagagttt
gtccagaagctggaagacaaagcagctaaaagctatatacagactctccccaagattcaa
aaaatggatttatctcttcttttccccagagccagtcctttagcagtggacttgcttgac
aagatgttgcagctggatgtggaaaggcgtcccacagccacgcaagctctggcccaccca
tattttgaccggttcagagatattgaggaagagacagaagcacaacactcctatgatgat
tctctggagggtgaaaagcttacaataaatgaatggaaaaggcatactttcagtgaaata
ctttcattcagcccaattgtaaggaaagactccaaaagaagaagtggtatgacgttgtag

DBGET integrated database retrieval system