KEGG   Gekko japonicus: 107110994
Entry
107110994         CDS       T04299                                 

Gene name
TBK1
Definition
(RefSeq) TANK binding kinase 1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
gja  Gekko japonicus
Pathway
gja04137  Mitophagy - animal
gja04140  Autophagy - animal
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107110994 (TBK1)
   04137 Mitophagy - animal
    107110994 (TBK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107110994 (TBK1)
   04621 NOD-like receptor signaling pathway
    107110994 (TBK1)
   04622 RIG-I-like receptor signaling pathway
    107110994 (TBK1)
   04623 Cytosolic DNA-sensing pathway
    107110994 (TBK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107110994 (TBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107110994 (TBK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107110994 (TBK1)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     107110994 (TBK1)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107110994 (TBK1)
Membrane trafficking [BR:gja04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    107110994 (TBK1)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like ubiquitin
Other DBs
NCBI-GeneID: 107110994
NCBI-ProteinID: XP_015267353
LinkDB
Position
Un
AA seq 729 aa
MQSTPNYLWLVSDILGQGATANVFRGRHKKTGDLYAVKVFNNFSFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTSRHKVLVMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLKDVV
AGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKEHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIEWSRDMPISCSLSKGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRIIIHVFSLQHMTAHKIYIHNYNTAAIFHELVFKQTKIALLNQELIYEGRRLV
LEPNRLTQHFPRTTEENPIIVVSREPVSIVGLLYEEILLPKVHQRYDLDSDASMAKAVTG
VVCYACRVARALLLYQELMRKGIRWLIEIIKDDCNETVHEKNEVVIKLEFCNRSLEKAGK
IYQDMRQMNLAPSEGDKISDIHSKLLRLSSSRGTIESSLQDIKSKLSPNGQLSDGWANQE
GTHLKDRNPERLQVLLSSISDIYYQFKKDKAERRLPYNEEQIHKFDKQKLFIHATKAMTL
FKEECVSKYEIFLDKAEDWMRKMLHLRRQLLTVRKQCFDIEEEVSKYQVFINELQETLPH
KMMAVSSGIKHAINPVYPSSNTLVEMTLGMKKLKEEMEGVVKELTENNHLLERFGALTMD
AGPQNVDCI
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgcagagcactccaaattatctctggcttgtatcagacatcctgggacaaggagctact
gcaaatgttttccggggacgacacaagaaaacgggtgacttgtatgctgtcaaagtattt
aataatttcagctttcttcgtcctgttgatgttcagatgcgtgagtttgaagtattaaag
aaactgaatcacaaaaacattgtaaaattatttgccattgaggaagagacaacctctaga
cataaagttctcgttatggaattttgtccatgcggcagtttgtatacagttttagaagag
ccatctaatgcctatggcttgccagaatcagaattcttgattgtgctgaaagatgttgtg
gctgggatgaatcatcttcgagagaatggaatagtgcatcgtgacattaaaccaggcaat
ataatgcgtgttataggtgaagatggtcagtctgtttataaattgacagattttggggct
gctagggaactggaagatgatgaacagtttgtctccctctatggtacagaagaatacttg
catcctgacatgtatgaacgtgcagtattgaggaaagagcaccaaaagaaatatggtgca
acggtcgacttgtggagcataggggtgactttttaccatgctgctactggaagtttaccc
tttcggccttttgaaggacctcgcagaaataaggaagtgatgtataaaattataactgga
aagccttctggtgcaatatctggagtacaaaaagcagaaaatggtccaattgaatggagc
cgggatatgccaatttcctgcagtctctctaaaggcctgcaagtactgctgacacctgtc
cttgcaaatattcttgaagcagatcaagagaagtgctggggatttgatcagttttttgca
gagactagcgacatactccatcgaataattattcatgtcttctctctgcaacacatgact
gcacacaaaatttatattcacaactataatactgctgccatatttcatgaactggtcttc
aaacaaacaaagatagccttgctaaatcaagaactgatatatgaaggccggcgtttagta
ctggagcccaatcgattgacacagcatttccccagaactactgaagaaaatcctataatt
gtagtaagcagggagcctgtgagcatcgtaggattactctatgaagaaattttacttccc
aaggtccatcaacgctatgacttggatagtgatgccagtatggctaaagcagtgacgggt
gttgtgtgttatgcttgtagagttgcccgtgctttattgctttaccaggaactgatgcga
aagggaattcgatggttaattgaaataattaaggacgattgcaatgaaacagtgcatgaa
aagaatgaggttgtcatcaagttagaattttgcaacagaagtttagagaaagctgggaaa
atatatcaagatatgcggcagatgaatctcgcaccatcagaaggagataaaatttcagac
atacattcaaagctgttacggctttccagttcacggggaaccatagagtctagtcttcag
gatattaaaagcaaactctctcctaatggtcagttgtctgatggttgggctaatcaggaa
ggcacacatctgaaagacagaaacccagaaagattacaagtactactgagttctatatca
gatatttattaccaattcaaaaaagacaaagctgaacgaagacttccttataatgaagaa
caaatacacaaatttgacaagcagaagctttttatacatgccacaaaagccatgactcta
ttcaaggaagaatgtgtcagcaagtatgaaatatttttggacaaggcagaggattggatg
aggaagatgctccacttaaggagacagttactgactgtcagaaagcagtgctttgatatt
gaagaagaggtatccaaataccaggtctttataaatgagttacaagaaactttgccccac
aagatgatggcagtttccagtgggatcaaacatgcaattaatccagtttatcctagttca
aatactttggtggaaatgactcttggcatgaagaaactgaaagaagaaatggagggtgtt
gttaaagaattaacagagaataatcatcttttggaaaggtttggagctttgactatggat
gctggcccacagaatgtggattgtatctag

DBGET integrated database retrieval system