KEGG   Gekko japonicus: 107111118Help
Entry
107111118         CDS       T04299                                 

Gene name
AASS
Definition
(RefSeq) aminoadipate-semialdehyde synthase
  KO
K14157  alpha-aminoadipic semialdehyde synthase [EC:1.5.1.8 1.5.1.9]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Module
gja_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107111118 (AASS)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.8  saccharopine dehydrogenase (NADP+, L-lysine-forming)
     107111118 (AASS)
    1.5.1.9  saccharopine dehydrogenase (NAD+, L-glutamate-forming)
     107111118 (AASS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sacchrp_dh_C AlaDh_PNT_N Sacchrp_dh_NADP AlaDh_PNT_C NAD_binding_10 Shikimate_DH DUF2325
Motif
Other DBs
NCBI-GeneID: 107111118
NCBI-ProteinID: XP_015267524
LinkDB All DBs
Position
Un
AA seq 928 aa AA seqDB search
MFQAFRHSGGRHGHQLFRCQHYHKSVLAIRREDVNAWERRAPLAPRHVKALAGLGYKVLV
QPSNRRAIHEKDYVKAGGIIQEDISEACLILGVKRPPEDKLISKKTYAFFSHTIKAQEAN
MPLLDEILRKDIRLIDYEKMVDHRGVRVVAFGKWAGVAGMINILHGMGLRFLALGHHTPF
MHIGMAHNYRNSSQAVQAVRDCGYEISLGLMPKSVGPITFVFTGTGNVSKGAQEMFNALP
CEFVEPHELKEVSRTGDLRKVYGTVLSRHHHLVRKSDGVYDPVEYDKHPECYTSRFNTDI
APYATCVINGIYWEQHTPRLLSRQDAQRLLTPLRPSASATEGCPELPHKLVAICDISADT
GGSIEFMTECTTIDSPFCMYDADQHIIHDSVEGLGILMCSIDNLPAQLPIESTECFGDML
FPYIEEMLLSDASEPLESQNYSPVVRDAVITSNGSLTDKYKYIQKLRESREYTQSLAMDK
KKKVLLLGSGYVSGPVIEYLLRDSRVEITAASVMKEQLEQLAKKHSRIVPVFMDVTKDEE
RLSSMVKKHDLVISLLPYSFHPSVAKKCIDSKVNLVTASYLTPAMKELQQSVEASGITVI
SEVGLDPGLDHMLAMECIDKAKEVGATVVSYTSFCGGLPAPEHSDNPLRYKFSWSPQGVL
LNTVQPATYLKNGEIVNIPAGGALLDSVTVMDFFPGLNLEGFPNRDSTKYAEPYGIQSAH
TLLRGTLRYSGYSKAVGGFVKLGLINTELCPLLSAEAPSTKWQELMCKLLGLKPSVKLDD
LREVVYNKLDKDERQLEAIEWLGLLGDEPVPRADTIVGALAKHMEIKLSFGTGERDMIVM
RSEIGISHPSGHLEDKHISLVVYGDAKGYSAMAKTVGYPTAIAAKMVLDGEINTKGMVIP
LTKNVYGPILERVQAEGIVYNIQSVIKQ
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggcattcagacattcaggtggtaggcatgggcaccaactgttcaggtgccag
cattatcataaatctgtgctggccatcaggagggaggatgttaacgcctgggaaagaaga
gcacctctggccccacggcatgtcaaagcattagccggcctgggatacaaggttctggtg
cagccatctaaccgaagggccatccacgagaaggattatgtcaaagctggtggcattata
caggaagatatttcagaggcctgtctgattttaggtgtgaaaagacctccagaggataaa
ctaatctccaagaagacgtatgcattcttctctcatactattaaagcccaagaggcaaat
atgcccttgttggatgagatcctaagaaaggacattcgattaatagattatgagaaaatg
gtggatcacagaggtgtgcgagttgtagcctttggaaagtgggctggtgttgcaggtatg
atcaatattttacatggaatgggattacgttttcttgctctgggtcaccatacacctttc
atgcacattggaatggcccataactacagaaacagcagccaggctgtgcaagcagttcgg
gactgtggctatgaaatttcattgggcttgatgccgaaatctgttggccccataacattt
gtgtttacaggtactggcaacgtttctaagggtgctcaagaaatgttcaatgcactccca
tgtgagtttgtagagccccatgagctgaaggaggtctccagaactggagacctccgaaaa
gtgtatgggactgtgctcagtcgacaccatcaccttgtaaggaagagcgatggggtatat
gaccctgtggaatatgacaagcatccggagtgctacacatctcgttttaacactgatatt
gcaccctatgcgacttgtgtaatcaatgggatctactgggagcagcataccccacgtttg
ctaagcaggcaggatgcacagagacttctgacaccgctcagaccttcggcttcagctact
gaaggctgcccagaattaccacacaagctcgttgcaatttgtgacatttcggcagacact
ggtggatcaatagaattcatgacggaatgtaccacgatcgacagccccttctgcatgtat
gatgccgaccagcacattattcatgacagtgtggaaggacttgggattttgatgtgttcc
attgataacttgccagctcaacttcccatagaatcgacagaatgttttggagacatgctt
ttcccttatattgaagaaatgctgttatcggacgcctctgagcccttggagagccagaat
tactcacctgttgttagagatgcagtgattacgtccaatggttcattgactgataagtat
aagtatatccagaaactgagggagagcagggagtacactcagtcactggccatggataag
aagaagaaagtcttgttactgggatctgggtatgtctctgggcctgtgatagaatacctc
ttgagagactcccgcgtcgaaataacagcagcgtctgtcatgaaggagcagcttgagcaa
ctggctaagaagcacagccgtatagttcctgtttttatggatgtcaccaaagacgaagag
agattatcatccatggtgaagaaacatgatcttgtgatcagtttgctgccttattcattc
catccttcagttgctaagaaatgtattgacagcaaagtgaacttggtaactgctagttac
ctgacaccagctatgaaagagctgcagcagagtgtagaggcttctggcatcacagttatc
agtgaagtaggtctggatcctggtcttgatcatatgctggcaatggagtgtattgataaa
gcgaaagaagtgggtgctacagtggtatcttacacatctttctgtggtggcctacctgct
ccagagcattccgataatcccctgagatacaaattcagttggagtccacaaggtgttctg
ctgaatactgttcagcctgccacatatttaaaaaatggagagattgttaatattccagct
ggaggagctttgcttgattctgttactgtcatggattttttcccaggattaaatttggaa
ggttttccaaacagggatagtaccaaatatgctgaaccctatggtattcaatcagctcac
actcttttaagagggacgttacgatacagcggttattctaaagctgtaggaggctttgta
aaattgggattaataaacacagagctgtgccctctgctgagtgcagaagcaccttctaca
aaatggcaagagctgatgtgtaagcttctggggcttaagccatctgtcaaattggatgat
ctccgagaagtcgtctacaataaactggacaaggatgaaaggcagctggaagcaatagaa
tggttgggattgcttggagatgagcctgttccaagagcagacactatagtgggtgcactg
gccaagcacatggagatcaagctgtcttttggcactggagaacgagatatgatagttatg
agaagtgaaataggaatcagccatccatctggtcatttggaagacaaacacatcagtctg
gtggtgtatggtgatgctaaaggatattctgcaatggctaaaaccgtagggtatcctaca
gccatcgcagccaaaatggtgcttgatggggaaattaacaccaaaggcatggtaatccca
ctgacgaagaatgtatatggaccaatactggaacgagttcaagctgaaggcattgtatat
aatatccagagcgttatcaagcaataa

DBGET integrated database retrieval system