KEGG   Gekko japonicus: 107111390Help
Entry
107111390         CDS       T04299                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
gja  Gekko japonicus
Pathway
gja00020  Citrate cycle (TCA cycle)
gja00190  Oxidative phosphorylation
gja01100  Metabolic pathways
gja01200  Carbon metabolism
Module
gja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gja_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107111390 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107111390 (SDHB)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107111390 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 107111390
NCBI-ProteinID: XP_015267842
LinkDB All DBs
Position
Un
AA seq 288 aa AA seqDB search
MAAAVTVGRAGFVSFRGGPLGVAVQACRGAHAAAAAAPLATEASPRIKKFAIYRWNPDSP
GEKPRMQTYEVDLNRCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLA
CTRRIDTNLSKVSKIYPLPHMYVVKDLVPDLSNFYAQYKAIQPYLKKKDESKQGKEQYLQ
SIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLA
QLEDPFSLYRCHTIMNCTKACPKGLNPGKAIAEIKKMMATYKEKAARA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgtgaccgtggggagggcgggattcgtgtccttcagaggcggccctctg
ggagtggcggtccaggcctgtcgcggagcacatgcagcggccgcagctgcccccctcgcc
acggaggcatccccgcgcatcaagaagtttgccatctaccggtggaacccagacagccct
ggagagaagccccgcatgcagacctacgaggtggacctgaacagatgcgggcctatggtt
ctcgatgccttaatcaaaataaaaaatgagatggactccacactgacgttccgccggtcc
tgccgggaaggcatttgcggctcctgcgccatgaatatcaacggggggaacaccttggcc
tgcaccaggaggatcgacacgaacctcagcaaggtctccaaaatctaccctctcccccac
atgtacgtggtgaaggacctcgtcccggatttgagcaacttctatgcccagtacaaagcg
atccagccttatttgaaaaagaaggacgagtccaagcagggcaaagagcaatacctccag
tccatagaagagcgtgaaaagctggacgggctgtacgaatgcatcctgtgtgcctgctgc
agcaccagctgccccagttactggtggaacggagacaagtacctgggccctgccgtgctc
atgcaggcctaccgctggatgatcgactcccgggacgactacacagaagagcggctggcg
cagctggaagaccccttctccctttaccgctgccacaccatcatgaactgtaccaaggcc
tgccccaaggggctgaaccccggaaaagccattgctgaaatcaagaagatgatggccacc
tacaaggagaaggcagccagagcttaa

DBGET integrated database retrieval system