KEGG   Gekko japonicus: 107111573Help
Entry
107111573         CDS       T04299                                 

Gene name
PLOD1
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
  KO
K00473  procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 [EC:1.14.11.4]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107111573 (PLOD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107111573 (PLOD1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     107111573 (PLOD1)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107111573 (PLOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anp1 2OG-FeII_Oxy_3
Motif
Other DBs
NCBI-GeneID: 107111573
NCBI-ProteinID: XP_015268038
LinkDB All DBs
Position
Un
AA seq 740 aa AA seqDB search
MPHSRLLLPLLLLLMDEGSYGSKQQHDNLLVLTVATKETEGFRRFQRSAQFFNYKIKVLG
LNEEWHGGDDKKTAGGGQKIRLLKSALEGYADQEDLVILFTESYDVIFASGPAELLKKFR
QAKSKVVFSSETLIYPDRKLEAKYPQVRDGKRFLGSGGFIGYAPYLSKLVADWQGQDSDS
DQLFYTTVFLDPEKRGSINISLDHKCRIFQNLNGALDEVVLKFEQGRVRARNLAFDTLPV
VIHGNGPTKLQLNYLGNYIPQIWTFETGCTVCREGLRSLSTLKEDALPLVLIGIFIEQPT
PFLTPFFQRLQKLHYPKKRIQLFIHNHEEHHLSQVDEFVEDHGEEYRSVKVVGPGDHVEN
ADARNMGIDMCRQDPACEYYFSIDAETVVKNPDTLRILIEQNKFVIAPLVGRLGKLWSNF
WGALSADGYYARSEDYIDIVQGRRVGLWNVPYISSIYLIKSSVLRSQLAQADLFHIGKLD
ADMAFCHNVREQGIFLFVTNQQHFGHILSLENYQTTHLHNDLWQIFSNPEDWKEKYIHEN
YTAALKGKGVETPCPDVYWFPLFTDTACDELVEEMENFGQWSKGGNTDNRILGGYENVPT
IDIHMNQINFEREWYKFLLDYIAPITEKLYPGYYTKTQFELAFVVRYKPDEQPSLMPHHD
ASTFTINIALNRVTKSAYSRLVLAFFTLQGGGCHFLRYNCSIRAPRKGWTLMHPGRLTHY
HEGLPTTKGTRYIAVSFLDP
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgccccatagccgcctgctccttccgctcctactgctcctgatggacgagggaagttat
gggtccaaacagcagcacgataatttattggttctaactgtggccaccaaggagacagaa
ggattccggcggttccagagatcagcccagttcttcaactacaagatcaaggtccttgga
ctaaacgaagaatggcatggcggagatgacaaaaagacagcaggaggcgggcagaagatc
cgtctcttgaaatcggctttggagggttatgcggaccaagaggatttggtcattctcttc
acagaaagttatgacgttatcttcgcatcgggccctgcggaactgttaaagaagttcagg
caggctaagtccaaagtcgtcttttcatcagagactctcatctaccctgaccgaaaactg
gaagccaaatacccgcaagtccgagatgggaagcggttcctgggttccggagggttcatt
ggctacgctccgtatctcagcaagctcgtggcagactggcaggggcaagacagcgacagt
gaccagctcttttataccaccgtcttcttggatccagaaaagcggggaagcatcaatatc
tctttagatcataagtgtcggatcttccaaaacctgaatggtgctttagatgaggtggtc
ctgaagttcgaacaaggtcgagtgagagcacgaaacctggcatttgacaccctccccgtc
gtgattcatggcaacggccccaccaagttgcagttaaattacctgggaaactacatcccg
caaatatggacctttgagacaggttgcacggtttgccgcgaaggcttgaggagtctctcc
accctcaaagaggatgcgctgccgctggttctgatcggcatcttcatcgagcagccgacc
ccgttcctcaccccgttcttccaaaggcttcagaagctccactacccgaagaaacggatc
cagttgttcattcacaatcacgaggagcatcacctctcccaggtggatgagtttgtggag
gaccacggagaagaatatcgctccgtcaaagtggtcgggccaggtgatcacgtggagaat
gctgacgctcggaacatgggcatagatatgtgcaggcaggatcctgcttgtgaatattac
ttcagcatcgatgctgagacggtggtcaagaacccagacacgctgcggatcctgatagaa
cagaacaagtttgtgatcgcccccctcgtcggccgcctggggaagctgtggtccaatttc
tggggcgccttgagtgccgatggctactacgcccgctcggaggactacatcgatatcgtc
cagggacggagagtcggtctctggaatgtcccgtacatctccagcatctacctgatcaaa
agcagtgtcctcagatcgcagctcgctcaggccgaccttttccacatcgggaagttagat
gcagacatggctttctgccacaacgtccgggagcagggcatcttcctgtttgtgacgaat
cagcagcactttgggcacatcctctccttggagaattaccagacgactcacctccacaac
gatctctggcagatctttagcaacccagaggactggaaggaaaaatacatccatgaaaac
tacaccgcagccttaaaaggcaagggggtagaaacgccctgcccagatgtgtattggttt
cctctgttcaccgacaccgcttgcgacgaactggtagaagagatggagaactttggccag
tggtccaagggaggtaacacggacaacaggatcctgggagggtacgagaacgtgccaacc
atcgacatccatatgaatcagatcaactttgagcgcgaatggtacaagttcctcctggac
tacatcgcgcccatcacagagaagctgtaccccgggtactacaccaaaacccagttcgag
ctggcctttgtggttcggtataaacctgacgagcagccatcgctgatgccgcaccatgac
gcatccactttcaccatcaacattgccctgaaccgtgtaacgaagtcagcatactcaagg
ctggttcttgctttcttcactctgcagggcggaggctgccacttcctgcggtacaactgt
tccatcagagcgccccggaaagggtggaccctcatgcacccgggtcgcctgacccattac
cacgaaggcctccccaccaccaaagggactcgttacattgctgtgtcctttcttgatccg
tag

KEGG   Gekko japonicus: 107112451Help
Entry
107112451         CDS       T04299                                 

Gene name
PLOD2
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
  KO
K13645  procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 [EC:1.14.11.4]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107112451 (PLOD2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     107112451 (PLOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anp1 2OG-FeII_Oxy
Motif
Other DBs
NCBI-GeneID: 107112451
NCBI-ProteinID: XP_015269069
LinkDB All DBs
Position
Un
AA seq 758 aa AA seqDB search
MAMSAAGPLALLLLGLAVSLLQPSRTAETEQPPIPADKLLILTVATKETDGFHRFVQSAK
HFNYTVKILGKGEEWKGGDALNSIGGGQKVRLLRSVMETYADQEDLVVMYVDCYDVLFAG
GSEELLKKFQQANHKVIFAADGLIWPDKRLSDKYPVVRSGKRFLNAGGFIGYAPYVNNIV
QHWDLQDNDDDQLFYTKLYIDHLKRERINITLDHKCNIFQTLNGAVDEVVLKFEDGRARA
KNSLYDTLPITLHGNGPTKVLLNYFGNYIPNGWSRETGCSACDTDLLDLDALNENPTVTI
GVFIEQPTPFLARFLDRLLTLEYAKEKLSLFIHNNEVYHEKHIKKFWEKAKNIISTIKIV
GPEENLSQADARNMGMDICRQNKDCDYYFSIDADVVLTNPQTLKLLIEQNRKIIAPLVTR
HGKLWSNFWGALSADGYYARSEDYVDIVQGNRVGVWNVPYVANIYLIKGQTLRSEMKERN
YFARDRLDPDMAFCRHAREMTLQREKDSPSAETFHMLSPPKGVFMYITNRHEFGRLLSTA
NYNISHYNNDLWQIFENPVEWKEIYINPNYSKIFTENIVEQPCPDVFWFPIFSETACDEL
VEEMEHYGQWSGGKHHDSRISGGYENVPTDDIHLKQVGLENEWLHFIREFIAPVTLKVFA
GYYTKGHALLNFVVKYTTERQRSLRPHHDASTFTINIALNKIGEDFQGGGCKFLRYNCSI
ESPRKGWSFMHPGRLTHLHEGLPILNGTRYIAVSFIDP
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgagtgcagctggacctctcgccctgctcctcctggggttagctgtctctctc
ttacagcccagccgcactgctgagaccgagcaaccgcccatccctgcagataagttatta
attctaactgttgcaaccaaggaaacagatggctttcaccgattcgtgcagtctgcaaag
cacttcaactacacagtaaagatccttgggaaaggtgaagagtggaaaggaggtgatgct
ctcaactctattggaggaggtcagaaagtccgactgctaagatctgtaatggagacttat
gcagatcaggaagatctggtggttatgtatgttgactgctatgatgttttatttgctggg
ggatctgaagaattgctaaagaagttccagcaagctaaccacaaagtaatatttgcagca
gatggattgatatggcctgataaaagactgtcagacaagtaccctgttgttcgcagcggt
aaacgattccttaatgcaggaggatttattggctatgctccatatgtaaacaatattgta
caacattgggaccttcaagataatgatgatgatcagcttttttataccaaactctacatt
gaccacttaaaaagggaacgtattaatattaccttggatcacaagtgcaatattttccag
actctaaatggagctgttgatgaagttgttctgaaatttgaagacggaagagccagagcc
aagaattcattgtatgatactttgccaatcactcttcatggaaatggcccaactaaagtt
cttctcaattactttgggaattatatccccaatggctggtcccgtgaaactggctgcagt
gcctgtgacacagatttacttgatctagatgcactaaatgagaatccaacagtaacaatt
ggagttttcattgaacaaccaactcctttcttggccaggtttttagacagattattgact
ctagaatatgcaaaagaaaaactttctctcttcattcataataatgaggtgtaccatgaa
aagcatatcaagaaattctgggaaaaagccaagaatattattagtactataaaaattgtt
ggacctgaagagaatctgagtcaagctgatgctaggaacatgggaatggacatctgtcgc
cagaacaaagactgtgactattacttcagcatagatgcggatgttgttttaacaaaccca
caaactttaaaactcctgatagaacaaaacagaaagataattgctcctcttgtaacccgt
cacgggaagctctggtccaacttttggggagcgttgagtgctgatggatattatgctcga
tctgaagactatgtggatattgtccaaggaaacagagtaggtgtatggaatgttccttat
gtagctaatatatacttgatcaaaggacagacactcagatcggagatgaaagagagaaat
tattttgcacgtgatagattggatcctgatatggccttctgcaggcatgccagggaaatg
actttgcaaagggaaaaagactccccttcagcggaaacattccatatgctcagcccccca
aagggtgtttttatgtacatcactaacagacatgaatttgggcgacttttatcaactgcc
aactacaatatttctcactacaacaatgacctctggcagatcttcgaaaatcctgtggaa
tggaaggaaatctatataaaccctaactattcaaagatcttcactgaaaatatagtggaa
cagccatgtccagatgtgttttggttccccatattttctgagacagcctgtgatgaactg
gtggaggaaatggaacattatggtcaatggtctggtggcaaacatcatgatagccggatt
tctggaggatatgaaaatgttccaactgatgacattcacttgaagcaagttgggctggag
aatgaatggctgcattttattagagaattcattgcacctgtaacactgaaagtatttgct
ggctactacacaaagggccatgccttgctaaattttgttgtaaaatatactactgagaga
cagcgatccctcagacctcatcacgatgcatcaacgtttactatcaacattgctcttaac
aaaataggagaagactttcaaggaggtggatgtaaatttctgaggtacaactgttcaatt
gagtcccctaggaaaggatggagtttcatgcatcccggaagacttactcatttacatgaa
ggacttcccattctgaatggaacaagatacattgcagtatcatttatagacccctaa

KEGG   Gekko japonicus: 107118151Help
Entry
107118151         CDS       T04299                                 

Gene name
PLOD3
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107118151 (PLOD3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107118151 (PLOD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107118151 (PLOD3)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     107118151 (PLOD3)
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107118151 (PLOD3)
    2.4.1.66  procollagen glucosyltransferase
     107118151 (PLOD3)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107118151 (PLOD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anp1 2OG-FeII_Oxy 2OG-FeII_Oxy_3
Motif
Other DBs
NCBI-GeneID: 107118151
NCBI-ProteinID: XP_015275912
LinkDB All DBs
Position
Un
AA seq 722 aa AA seqDB search
MAEWKFRPESNSPVMWASKGKLLVLTAATEETEGYQRFLRTTKYFNYTVKTLGLGEDWKG
GDVARTVGGGQKVRWLKAEMKKYVNEEDLIVMFVDSYDVILAGGPVELLQKFQQFDSNLV
FSAESFCWPEWSLAEKYPPVAVGNRFLNSGGFIGYASVINRVVQLWKYKDDDDDQLFYTR
IYLDPALREKYGITLDHKSKIFQNLNGAIEEVVLKFEPIRVRARNVAYDTLPVVIHGNGP
TKLQLNYLGNYIPNVWTYEGGCEVCDQGLLDLSSLADDSYPHVLIGVFIEQPTPFLPEFL
QRLLTFDYPYSRLSLFIHNREVYHEQHIQAEWEHLQGAFDSIKLVGPEEEMSEGEARDMA
MDLCRQDLACGYYFSLDADVVVVNPEILQILIQDNKKVIAPMMSRHGKLWSNFWGALSPE
GYYARSEDYVELVQGKRIGVWNVPYISQAYLLRGETLRSELVQQHVFTLDDMDPDMAFCK
SVREKGIFLHISNRDEFGRLLSTASFNTSRLHPDLWQIMENPLDWQEKYIHENYSQVLEG
ESHMQPCPDVYWFPVFTDQMCDELVEEAENFGQWSGGKHEDTRLAGGYENVPTVDIHMNQ
IGFEKEWLRFLQEYIAPVTEKLYPGYYTKARAIMNFMVRYRPDEQPFLRPHHDSSTFTIN
IALNHKGVDYQGGGCRFIRYNCTVESPRKGWSLMHPGRLTHYHEGLPTTSGTRYIMVSFV
DP
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtggaagttcagacctgaaagcaacagcccggtgatgtgggctagcaaaggg
aagctgctggtactgacggcagccacggaggagacggaagggtaccagcgcttcctacga
acaaccaaatacttcaactacacggtcaagactcttggcctaggggaggactggaaggga
ggggatgttgcccggacggttggcggagggcagaaagtccgctggctgaaggcagaaatg
aagaagtatgtcaatgaggaagacctgatagtcatgtttgtggacagctatgacgtgatc
ctggccggcggccccgtcgaacttctgcagaagttccagcagttcgacagcaacttggtc
ttctcggcggaaagcttctgctggccggagtggtcgctggcggaaaagtaccccccagtg
gctgtgggaaaccggtttctcaactccggaggattcattggctatgcttccgtcatcaat
cgcgttgtccagctatggaagtacaaggatgacgacgacgaccagctcttctacacgcgt
atttacttggatcctgccttgcgggagaaatatgggatcaccctggatcacaagtcaaaa
atctttcagaacctgaatggcgccattgaggaagtcgttctgaagttcgaaccgatccgg
gtgcgtgcccgaaatgtcgcctacgacaccctacctgttgtcatccatggcaatggccct
accaagctgcagctgaactacctggggaattacatccccaatgtctggacatacgagggg
ggttgtgaagtgtgtgaccaaggactcctggacctgtcaagcttggcggacgactcctat
ccccacgtgctcattggcgtgttcatcgagcagccgactcccttcctgcctgagttcctt
cagcgtctcctgacctttgattacccttactctcgcctcagcctcttcatccacaaccgg
gaggtgtatcacgagcagcacatccaggccgagtgggagcaccttcagggggccttcgac
agcatcaagctcgtgggtccagaggaggaaatgagtgagggcgaggccagagatatggcc
atggacctctgccgccaggaccttgcctgtggctattacttcagcctggatgccgacgtg
gtcgtggtgaaccccgagatcctgcagattctcatccaggataacaagaaggtgatcgct
cccatgatgtcccggcatggaaagctctggtccaatttctggggggccctgagccccgaa
ggatactacgcccgctcggaggactacgtggaactggtgcagggcaagaggataggtgtg
tggaacgtcccttacatctcccaggcttacttgctgaggggggagacgttacgcagcgag
ctggtccagcagcacgtcttcactttggacgacatggacccggatatggctttctgcaag
agtgtgcgggaaaagggtatcttccttcacatcagcaaccgggacgagttcgggcgtctc
ctttccaccgccagcttcaacacatcccgtctgcatccggacctctggcagatcatggag
aaccccctggactggcaggagaaatacatccatgagaattactcacaagtgctggagggg
gaaagccacatgcagccgtgccctgacgtttactggttcccagtgttcaccgaccagatg
tgtgatgagctggtggaagaggctgaaaactttggccagtggtcgggggggaagcacgag
gacaccagactggctggcggctacgagaacgtcccgactgtcgatatccacatgaatcaa
attggctttgagaaggagtggctccggttcctacaagaatacatcgcgcccgtcacagag
aagctctatcctggctactacaccaaggctcgggcaatcatgaacttcatggtccggtac
cgacctgatgagcaacccttcctccgtccacatcacgattcatccactttcaccatcaat
attgctctcaaccataaaggagtggactatcagggcggaggctgccggtttatccgctac
aactgcactgtggaatccccccgcaagggctggagcttgatgcaccccggacgcctcact
cactaccacgaaggactgcccacgaccagtggcacccgctacatcatggtctcttttgtg
gacccctaa

DBGET integrated database retrieval system