KEGG   Gekko japonicus: 107111867
Entry
107111867         CDS       T04299                                 

Gene name
JUN
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04137  Mitophagy - animal
gja04210  Apoptosis
gja04310  Wnt signaling pathway
gja04510  Focal adhesion
gja04530  Tight junction
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04912  GnRH signaling pathway
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107111867 (JUN)
   04012 ErbB signaling pathway
    107111867 (JUN)
   04310 Wnt signaling pathway
    107111867 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107111867 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    107111867 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107111867 (JUN)
   04530 Tight junction
    107111867 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107111867 (JUN)
   04621 NOD-like receptor signaling pathway
    107111867 (JUN)
   04625 C-type lectin receptor signaling pathway
    107111867 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107111867 (JUN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107111867 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107111867 (JUN)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107111867 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha FlaC_arch NBP1 Jnk-SapK_ap_N DUF3450 Spc29
Other DBs
NCBI-GeneID: 107111867
NCBI-ProteinID: XP_015268400
LinkDB
Position
Un
AA seq 313 aa
MTAKMEPTFYDDAINATFVQPESGTYGYNNPKVLKQSMTLNLADPASNLKPHLRNKNADI
LTSPDVGLLKLASPELERLIIQSGNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHNQNTMPSVTSAAQPVNTGMAPVSSMAGNSGFTASLHSEPPVYANLSNFNPNTLSAAPN
YNANNLGYPPQHLNPQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERK
RMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNS
GCQLMLTQQLQTF
NT seq 942 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaacctactttttatgatgatgccataaatgctacctttgtacag
ccggaaagtggtacttatggatataacaatcccaaagttctgaagcagagtatgactctg
aatctggctgaccctgccagcaacctcaagccccacctgaggaacaagaatgctgacatc
ctaacctccccagatgtaggcctcctcaagctggcgtctccagaactagaaaggctgatc
atccagtctggcaatggcctgatcaccaccactcctaccccgacccaattcctctgtccc
aaaaatgtcaccgatgagcaagaagggtttgcagaaggctttgtcagggcacttgcagaa
ctacacaaccaaaacaccatgccaagtgttacttctgctgcccagcctgttaacaccggc
atggcccctgtctcatcaatggctggaaacagtggcttcactgctagtttgcacagtgag
cctccagtctatgccaacctcagcaatttcaatccaaataccctcagtgcagcacctaac
tacaatgcaaacaacctgggctatcctcctcagcacctaaacccccagatgccagtgcag
catccccgccttcaagcgctgaaagaagaacctcagaccgtccctgagatgcctggggag
actcctcccttgtcccctattgacatggaatcccaggagaggatcaaggcagagaggaag
cgcatgagaaaccgaattgcagcctccaagtgtcggaaaaggaaattggaacggattgcc
aggttggaagaaaaagtgaaaactttgaaagcgcaaaactcggaactggcatctactgcc
aatatgctgcgagagcaggttgctcagctgaagcagaaagtcatgaatcatgtcaacagt
gggtgccagctaatgttaacacagcagttgcaaactttttga

DBGET integrated database retrieval system