KEGG   Gekko japonicus: 107111947Help
Entry
107111947         CDS       T04299                                 

Gene name
ACAT2
Definition
(RefSeq) acetyl-CoA acetyltransferase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gja  Gekko japonicus
Pathway
gja00071  Fatty acid degradation
gja00072  Synthesis and degradation of ketone bodies
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00380  Tryptophan metabolism
gja00620  Pyruvate metabolism
gja00630  Glyoxylate and dicarboxylate metabolism
gja00640  Propanoate metabolism
gja00650  Butanoate metabolism
gja00900  Terpenoid backbone biosynthesis
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja01212  Fatty acid metabolism
Module
gja_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107111947 (ACAT2)
   00630 Glyoxylate and dicarboxylate metabolism
    107111947 (ACAT2)
   00640 Propanoate metabolism
    107111947 (ACAT2)
   00650 Butanoate metabolism
    107111947 (ACAT2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107111947 (ACAT2)
   00072 Synthesis and degradation of ketone bodies
    107111947 (ACAT2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107111947 (ACAT2)
   00310 Lysine degradation
    107111947 (ACAT2)
   00380 Tryptophan metabolism
    107111947 (ACAT2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    107111947 (ACAT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107111947 (ACAT2)
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     107111947 (ACAT2)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107111947 (ACAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-GeneID: 107111947
NCBI-ProteinID: XP_015268478
LinkDB All DBs
Position
Un
AA seq 396 aa AA seqDB search
MSSAGEAVVLVAAARTPVGSFSGTLSTLHAHELGSVAVKEVLKRANVKPEEVSEVIFGQV
LAAGAGQNPARQASVGAGIPYAVPAWSCQMICGSGLKAVCLGAQSIMTGESSVVVAGGME
SMSKAPHIIHMRSGVKMGDACLQDSIILDGLTDAFYHYHMGITAENVAKQWKVSREEQDH
LAVNSQNKAENAQKAGYFEKEIVPVLVPSRKGPVEVKADEYPRHGSNLEVMAKLKPYFVT
DGTGTVTAANASGINDGAAAVILMKKAEALRRSLTPLAQIVSWAQVGVDPSVMGIAPAPA
IKKAVEKAGWTMDQVDLFEINEAFASLGVAVTRELKLNPEKVNIEGGAVALGHPLGASGC
RILVTLVYALERTGKKRGVAALCIGGGMGIAMCVER
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgctggggaagcggtcgtgctggttgctgctgcaaggaccccggttggatcc
ttcagtggtacattgtctaccttgcatgcccatgagctcggttctgtagctgtgaaggaa
gtcttgaagagggcaaatgtcaagcctgaagaagtatctgaagttatatttggccaagtc
ttggcagcaggtgccggtcagaatcctgctcgacaagccagtgttggtgcagggattcca
tatgcggtaccagcttggagctgccaaatgatatgtggttcgggtctaaaagctgtatgc
ctgggagctcagtccattatgacaggagagtccagtgttgtggtggctggaggcatggaa
agcatgagcaaggcaccgcacatcattcatatgcgcagtggcgtgaagatgggagatgcc
tgtttgcaggacagtattatcttagatggtttgacagatgccttttatcactaccacatg
ggtataactgctgaaaatgtggccaagcaatggaaagtcagtcgagaggagcaagaccat
ctggctgtaaactcgcagaacaaggctgaaaatgctcagaaggctggctattttgagaaa
gagattgtccctgttcttgttccttctaggaaaggtcctgttgaagttaaagcagatgag
tacccccgccatggtagtaacttagaagtgatggcaaaactaaagccttactttgtgaca
gatggaacaggaactgtgactgcagcaaatgcttcaggtattaacgatggtgccgcagct
gtaattcttatgaaaaaagcggaagcgctcagacgaagtcttacacctttggcacagatt
gtgtcttgggctcaagttggtgtagacccttctgtaatggggatagcacctgccccagcc
ataaagaaagctgttgaaaaagcaggttggacaatggaccaagttgacttgtttgaaatt
aatgaggcctttgcttcactaggtgtagcagtaacgagagagctaaaattgaaccccgaa
aaggttaacattgaaggtggggctgttgcccttggtcatcccttgggagcatctggatgt
cgcatccttgttactctggtgtatgcactggagcgaacaggcaaaaagcggggagttgct
gccttgtgcataggaggagggatgggcatagctatgtgtgtagaaagatag

KEGG   Gekko japonicus: 107113475Help
Entry
107113475         CDS       T04299                                 

Gene name
ACAT1
Definition
(RefSeq) acetyl-CoA acetyltransferase 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gja  Gekko japonicus
Pathway
gja00071  Fatty acid degradation
gja00072  Synthesis and degradation of ketone bodies
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00380  Tryptophan metabolism
gja00620  Pyruvate metabolism
gja00630  Glyoxylate and dicarboxylate metabolism
gja00640  Propanoate metabolism
gja00650  Butanoate metabolism
gja00900  Terpenoid backbone biosynthesis
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja01212  Fatty acid metabolism
Module
gja_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107113475 (ACAT1)
   00630 Glyoxylate and dicarboxylate metabolism
    107113475 (ACAT1)
   00640 Propanoate metabolism
    107113475 (ACAT1)
   00650 Butanoate metabolism
    107113475 (ACAT1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107113475 (ACAT1)
   00072 Synthesis and degradation of ketone bodies
    107113475 (ACAT1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107113475 (ACAT1)
   00310 Lysine degradation
    107113475 (ACAT1)
   00380 Tryptophan metabolism
    107113475 (ACAT1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    107113475 (ACAT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107113475 (ACAT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     107113475 (ACAT1)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107113475 (ACAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 107113475
NCBI-ProteinID: XP_015270296
LinkDB All DBs
Position
Un
AA seq 366 aa AA seqDB search
MMGGRQVPKALRAMMYASRGYSSQRALNDVVIVSAARTPIGSFQGSLFSLPATALGSVAI
KGAIERAGIPKEEVKEVYMGNVIQAGQGQAPARQATLGAGLPVSTPCTTVNKVCASGMKS
VMMAAQNLMCGNQDVMVAGGMESMSNVPYTMSRGTTPYGGVKLEDLIVKDGLTDVYNKIH
MGLKPDTEFKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTSEAA
KRLNVKPLARIAAFADAAVDPIDFPIAPAHAVPKILSQAGLKKEDIAMWEINEAFSVVVL
ANIKMLGIDPEKVNIHGGAVSLGHPIGMSGARIVVHMTHALKQGEYGLAGICNGGGGASA
ILIQKL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcggacggcaggtgccgaaggcgcttcgggcaatgatgtatgcaagccggggc
tattcatcacaacgtgctttaaatgacgtagtcattgtaagcgctgcccgtacacccatc
ggctcttttcagggatctcttttctcactaccagccactgctcttggctctgttgctatt
aaaggagcaattgaaagagcaggcatcccgaaagaagaagtgaaggaagtatacatgggt
aatgttatccaggctgggcaaggacaagctcctgcaagacaagcaacacttggtgcaggt
ttaccagtttctactccttgcacaactgtcaacaaggtttgcgcttctggaatgaaatct
gttatgatggcagcacagaacctgatgtgtgggaatcaggatgtgatggtggctggtggg
atggagagcatgtctaatgtgccctatacaatgagcagaggaacaacaccttatggagga
gtaaagctggaagacctgattgtgaaagatggtttaacagatgtttacaataaaatccac
atgggattgaaaccagacacagagtttaaagaagacgaagagtacaagcgtgttgatttt
agtaaagttccaaagttgaagacagtttttcagaaagaaaatggcacagtaacggctgcc
aatgccagtaccctcaatgacggagcagctgctttggtgctgatgacttcagaagcagcc
aagaggctaaatgttaaaccattggctaggatagcagcttttgcagatgctgctgttgat
cctatcgacttccccatcgccccggcacatgctgttcccaagatactgagtcaggcagga
ctcaaaaaagaagatattgcaatgtgggaaatcaatgaagcattcagcgttgttgtccta
gccaatatcaagatgctgggcattgatccggagaaggtgaacattcacggaggagcagtc
tctttaggacatccaattggaatgtctggagcaagaattgttgttcacatgacccatgcc
ctgaagcaaggagagtatggcctagctggaatttgcaatggaggcggtggtgcatctgca
attctgattcaaaagttgtag

DBGET integrated database retrieval system