KEGG   Gekko japonicus: 107112391Help
Entry
107112391         CDS       T04299                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00260  Glycine, serine and threonine metabolism
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107112391 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    107112391 (ALDH7A1)
   00620 Pyruvate metabolism
    107112391 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107112391 (ALDH7A1)
   00561 Glycerolipid metabolism
    107112391 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107112391 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    107112391 (ALDH7A1)
   00310 Lysine degradation
    107112391 (ALDH7A1)
   00330 Arginine and proline metabolism
    107112391 (ALDH7A1)
   00340 Histidine metabolism
    107112391 (ALDH7A1)
   00380 Tryptophan metabolism
    107112391 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107112391 (ALDH7A1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107112391 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     107112391 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     107112391 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107112391
NCBI-ProteinID: XP_015268999
LinkDB All DBs
Position
Un
AA seq 542 aa AA seqDB search
MMLLKLSLAAFSRRVFLRERVLSFSFRPAAPMSTLLVSQPQYAWLKELGLKEENEGVYNG
TWGGRGEVVTTYCPANNEPIARVRQASLEDYEETVKKAKEAWKVWAEVPAPKRGEIVKQI
GDTLRQKIKVLGNLVSLEMGKILIEGVGEVQEYVDICDYAVGLSRMIGGPMLPSERPGHA
LIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMVCGNVCLWKGAPTTSLVSVAVTKIIAQV
LEANKLPGAICSLTCGGADIGKAMAKDERVDLLSFTGSTNVGKQVALMVQDRFGRSLLEL
GGNNAIIVFEDADLNLVIPSALFAAVGTTGQRCTTARRLLLHENIHDEVVGKLTKAYAQI
RIGDPWDANTLYGPLHTKQAVKMFLDAVELAKQQGGSVAYGGKVIERPGNYVEPTIVTGL
PHNASIVQTETFAPILYVLKFKTEEEAFAWNNEVRQGLSSSIFTKDLGRIFRWLGPKGSD
CGVVNVNIPTSGAEIGGAVGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIK
FQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgttgaagttgagcctcgccgcgttctcgcgacgcgttttcctgcgggagaga
gtcctgagcttttccttcagacccgctgcgcccatgtcgacgctgctggtcagtcagcct
caatatgcgtggctcaaagagctgggactgaaagaagaaaacgagggtgtttacaatggc
acctggggaggaagaggagaggttgtgacaacgtattgccctgctaacaatgagccaata
gccagagttcgtcaggccagcttggaagactatgaagaaacagtaaagaaagctaaagag
gcttggaaagtatgggcagaggttcctgcacctaaacgaggagaaattgtgaaacaaatt
ggtgatactttacgacagaaaatcaaagtcctggggaacttggtttccttagagatgggg
aaaatccttatcgaaggtgttggtgaagtccaggaatatgtggatatctgtgattatgct
gttggtttatcccgaatgatcggaggaccaatgttgccttcagaaagacctggtcatgcc
ttaatagagcaatggaatcctgtgggattggtaggaatcatcactgcctttaattttccc
gtagcagtttatggctggaacaatgcaattgcaatggtctgtggcaatgtctgcctctgg
aaaggtgctcctacaacatcccttgtgagtgtagctgttacaaaaataattgcccaggtt
ttggaagctaacaaactccctggtgcgatctgttctcttacatgtggtggtgcagatatt
ggcaaagcaatggcaaaagatgaaagagttgatctgctctccttcactggtagcactaat
gtgggcaaacaggtagcactgatggtacaagacagatttggacggagtttgttggagctt
ggtggaaacaatgctattatcgtgtttgaagatgcagaccttaatctagtcattccatca
gctctctttgcagctgtggggacaacaggccagaggtgcacaacggccaggaggctgctt
ttgcatgaaaacatccatgatgaagtagtgggaaagctcactaaggcatacgcacaaatc
cgcattggagatccttgggatgctaacaccctgtatggtcccctccatacaaagcaagca
gtgaagatgttcctggatgcagtggagctggctaagcagcaaggaggctctgtggcctat
ggtgggaaggttatagaacgtcctggaaactatgttgaaccaaccattgtgactggtctt
ccacataatgcatccattgtgcagacagaaacatttgcccctattctctatgtgctaaaa
ttcaagacagaagaagaagcctttgcttggaacaatgaagtaagacaaggtctctccagc
agcatttttacgaaggatttgggcaggatattccgatggcttggacctaagggatcagac
tgtggcgttgtaaatgtcaatattccaactagtggggctgaaattggaggagctgttggt
ggtgaaaagcacactggcggtggaagggaatctggcagtgactcatggaaacaatatatg
agacgatcaacttgtacaatcaattacagcaaagatttgcctctggctcaagggatcaag
tttcagtaa

DBGET integrated database retrieval system