KEGG   Gekko japonicus: 107112894Help
Entry
107112894         CDS       T04299                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107112894 (MAPK6)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107112894 (MAPK6)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107112894 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 107112894
NCBI-ProteinID: XP_015269583
LinkDB All DBs
Position
Un
AA seq 720 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPNGSQLTDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIKNDMTEPHRPLTQLLAGISPEALDFLEQILTFS
PMDRLTAEDALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDDSHSHIYNWERYHES
QFSDHDWPIHNNFEADEVQRDPRALSDGTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWPYPDHHENKYCDLECSHTCNYKMRSTSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAEKEREKHQGFDFDSFIAGTIQLSLQ
HESTEVDKLNDLNSSVSHLESKGISKSVSREKQEKGMANLAQLEALYQTSWDSQLVSGGE
ECFLIGQFCCEVRKDEQIEKENTYTSYLDRFFSKKEDAEVLEAEPVEDGKLEEKDREGSF
ISNSGEFLFNKHLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHLN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgaaagccttatgaacattcatggttttgacctgggttctcggtat
atggacttaaaaccactgggctgcggtggcaacggcttagttttttctgctgtcgataat
gactgtgacaaaagagtggctgtcaagaaaattgtccttacagatcctcagagtgttaag
catgctctgcgtgagatcaaaatcatcagaaggcttgaccacgacaacatcgtcaaggta
tttgaaatcctcggtcccaacgggagtcagttgacggatgacgtgggctctctgacagaa
ctgaactgtgtttacattgtccaagagtacatggagacggatctggccaacctgctggag
caagggcccttactggaagaacacgccagactcttcatgtaccagctgctacgtggcctc
aagtacatacactctgcaaacgtcctgcacagagatctcaaaccagctaacctgttcatt
aatactgaagacttggtgctgaaaattggtgactttggtcttgcacggattatggaccct
cactattcccacaagggccatctttctgaaggattggtaactaaatggtacagatcacct
cgccttttgctgtctcccaacaactatactaaagccattgatatgtgggctgcaggttgc
atctttgctgaaatgctgacagggaaaactctctttgcaggcgcacacgaacttgaacag
atgcagctgattttagaatcgattcctgttgttcatgaggaagatcgtcaagaacttctg
aacgtcatcccagtttacattaaaaacgacatgactgagccacacagacctttaactcag
ctcctcgcaggcattagccccgaagcactggacttcctggaacaaatattgaccttcagt
cccatggatcgattgacagcagaagacgctttgtcccatccttatatgagcatttactcc
ttcccaaccgatgagcccatttcaagccatccctttcacattgaggatgaggtggacgac
attctgctcatggatgatagtcacagtcacatctataattgggaaagataccacgaaagt
cagttttcagaccacgactggcctatccataacaactttgaagctgatgaagttcagcgt
gacccaagagctctttccgatgggactgatgaggaagaagttcaagtagatcctcgcaaa
tatttggatggcgaccgtgagaagtatctggaggatccggcttttgatacccacttctct
actgagccttgttggccatatccagatcaccatgaaaacaagtattgtgatctggaatgt
agccacacctgtaattacaaaatgaggtctacttcctacctagataatttagtttggaga
gagagtgaagtgaaccattattatgaacccaagcttataatagatctttctaactggaag
gagcaaagtaaagagaagtcagacaagaaaggcaagtccaaatgtgaaaggaatggcttg
gtgaaggcccagatagcacttgaggaggcctcccagcagcttgctgaaaaggagagagaa
aagcatcaggggtttgactttgattcgttcatagcaggaaccatccagcttagcttgcag
cacgagtcgactgaagtggataaattaaacgacttgaatagttcagtgtcccacctagaa
tcgaaaggcatatcaaagtcagtaagtagagagaagcaagaaaaaggcatggccaacttg
gcgcagttagaagctctgtaccagacctcctgggatagtcagctggtgagcgggggggag
gagtgttttctcataggccagttttgttgcgaagtcaggaaggacgagcagatagagaag
gagaacacctacaccagttacctggacaggttttttagcaagaaggaggatgctgaagtg
ctggaagctgagccagttgaagatgggaagcttgaggagaaggacagagaaggaagcttc
attagtaatagcggggaatttctttttaacaagcacctcgaagctataggcatcccccag
tttcacagccctgttggctccccacttaaatcaatacaggccacgttaacgccttctgct
atgaaatcatctcctcagattccccataagacgtacagcagcattctgaaacacctaaac
taa

DBGET integrated database retrieval system