KEGG   Gekko japonicus: 107113068
Entry
107113068         CDS       T04299                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107113068 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107113068 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gja04052]
    107113068 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:gja00536]
    107113068 (FGF1)
Cytokines and growth factors [BR:gja04052]
 Growth factors
  Growth factors (RTK binding)
   107113068 (FGF1)
Glycosaminoglycan binding proteins [BR:gja00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107113068 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107113068
NCBI-ProteinID: XP_015269804
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFTALTEMFDLPMADYRKPKLLYCSNGGHFLRIRPDGKVDGTRDRNDQHIQLL
LTAENIGEVYIQSMESGQYLAMDDNGLLYGSQLPTEECLFLEKMEENHYNTYTSKKHADK
NWFVGLKKNGKSKLGPRTHFGQKAILFLPLPVPPD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaataacaacattcacggctctgacagaaatgtttgaccttccaatg
gcagattacaggaagcccaagctgctttactgcagcaatggaggccactttttgaggata
cgtcctgatggcaaagtcgatggcacgagggaccgaaatgaccaacacattcagttgctg
ctaactgcggaaaatattggtgaggtgtatatacagagcatggagtctggacagtacttg
gctatggatgacaatgggcttttatatggctcgcagttaccaacggaagaatgtttgttt
ctggaaaagatggaagaaaaccattataatacctatacatcgaagaaacatgcagataag
aactggtttgttggcttaaaaaagaatggaaaaagtaaactgggaccacggacacatttt
ggccaaaaggctatacttttccttccactaccagtgcctccggattag

DBGET integrated database retrieval system