KEGG   Gekko japonicus: 107113579
Entry
107113579         CDS       T04299                                 

Gene name
GOLGA2
Definition
(RefSeq) golgin A2
  KO
K20358  golgin subfamily A member 2
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107113579 (GOLGA2)
Membrane trafficking [BR:gja04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    107113579 (GOLGA2)
SSDB
Motif
Pfam: GOLGA2L5 GM130_C DivIVA
Other DBs
NCBI-GeneID: 107113579
NCBI-ProteinID: XP_015270412
LinkDB
Position
Un
AA seq 1034 aa
MALKENQQKNSPGITTGAKKKRKGKEGSRPESPTNDGRESPENIQNILKVLVSDLNRSNG
VAIPSLDKRKAYCDGGVSTHNAEQLAAGVPTLSNSVPSSAAPGPASTHPPQICDSDIHTN
ALEENRSLSLTESLRQLSEQLNGMVNQPTPYVNGESSTSSTDMREMATRYQELAVALDSS
NLTNKQLSTKVEELKQQNQEAMNQLEKEKKGFEQKFAKEQGALREQLQVHIQTIGILVSE
KSELQTALTHTQQAARQKAGEVEDLASRLQSSRQRISELEHTLSTISTQQKQSEKHSKEL
AKERDGLKLEVYKQSKSSDELKQQNSELSEKLHALISENSSMKLDVEDLHKKLEMAELMI
QQFASQPGIPDATQQLQTALEERANLEAQIAQLAESLQQLQAERDQYAHKLKEEGGIWQQ
RVQLLSEQIHTLTEEKDLNVTRIQELEANLSELLNSQSAPKPQESEPPPPAGPTEAELRL
QDEVSQLQQDKEELREQCRAQVQDNKQLSRLNREQEERLLELEKALQRYSEEAVDRQQIL
EHMQSDKATISRALTQNRELKEQLAELQNGFVKLTNENMEVTSALQSEQHVKKELARKIG
ELQEKLAELKETVDQKTREAEALQEQRDQYYGHLQQYTAAYQHLASEKEELHKQYLLQTQ
LMDRLQHEEVQGKVTAEVHFKELQEAKESLEVVAKENKELQAHVSQLMAELDAKMLPRAE
GDGVETEEETVEDMKTSLIIPEEFEDREEMVAFLTSSVSQVEQEREEMRQQLAEQKRQCR
GLLQEIAALRKEQQLHVASGAPGPAADSVPGEVHEALKSAMEKLQSRFTELMREKAELKD
RVEELEHRCIQLSGETDTIGEYIALYQSQRAILKQRHREKEEYISRLAQDKEEMKMKLLE
LQELVMRLVGERNEWYTKYTRVAQNLEPKPGPGSEAAVTLERRLELDATDGEGLREVSLT
DEPEQEMAVPASHRFHADDKGPPPAPHDPTAKQIMQLLREIQNPRERLGSLLENPCIPFF
YRADENDEVKIMVV
NT seq 3105 nt   +upstreamnt  +downstreamnt
atggcactgaaagaaaatcagcagaagaacagcccaggaataacaactggagccaagaag
aaacgcaaaggtaaagaaggaagtaggccggagtcgccaactaatgacggcagggagtct
cctgaaaacattcagaacattctgaaggtgctggtgtcagaccttaaccgctccaatggg
gtagccataccttcattggacaagaggaaggcatactgtgatggtggtgtttccactcat
aatgctgaacaacttgctgctggtgtccccacgttgtctaacagcgtgcctagctctgcc
gctccgggtcctgctagcacacatccgccacagatctgtgactctgatattcatacaaat
gccttggaagaaaataggtccctctctttgacagaaagtctccgccagctttctgagcag
cttaatggcatggtcaatcagcctacaccctatgtgaatggggaaagttccacgtcttcc
actgatatgagagagatggcgacacgttaccaggagctggcagtagccctggactccagt
aatctaacaaacaaacaactcagtacaaaggtagaggaattgaaacagcagaatcaagag
gccatgaatcagctggagaaggaaaagaaggggtttgagcagaaatttgcaaaggagcaa
ggagcattgcgagagcagttacaggtccacattcagactataggaatcctggtttcagaa
aagtctgaactgcagacagccctgacacatacgcagcaggccgctcggcagaaagcagga
gaagttgaggaccttgcttctcggttgcagtcctctcgccagaggatatctgagctggag
cacactctttccaccatctctacccaacagaagcagtcagagaaacatagtaaagagttg
gcaaaagaacgagacggcctgaaactggaagtctacaagcagagcaaaagcagtgacgaa
ctaaagcagcagaactccgaactgtcagagaagctgcatgcgctgatctcagagaactcg
tccatgaagttggatgtggaagatttgcataagaaactggaaatggcagagctgatgatt
cagcagtttgcaagtcagcctgggatcccggacgccactcagcagctgcaaacggccctg
gaggagagagccaacttagaagcacagattgcccagctggcggagtcgctccagcagctc
caggctgaacgggatcagtatgcccacaagctgaaggaggaagggggaatctggcagcag
agggtacagctgctgtccgagcagatccatactttgacagaagagaaggacctgaatgtg
acgcgcatccaggagctggaagctaacttgtctgagctgctcaacagtcagtcggccccg
aagccccaggagagtgagccgccccccccagcagggcccacggaagcagagctgcgcttg
caggatgaggtcagccagctgcagcaggacaaggaggagcttcgtgagcagtgccgggcc
caggtgcaggacaacaagcagctgagccgcctcaatcgcgagcaggaggagcggctgctg
gagctggagaaggcgctgcagcgctacagcgaggaggctgtggacaggcagcagatcctg
gagcacatgcagagcgacaaggcgaccatcagccgggccctgacccagaaccgggagctc
aaggagcagctggccgagctgcagaatgggtttgtcaaactgaccaatgagaacatggag
gtgacgagtgccttgcagtccgagcagcacgtgaagaaggagctggcaagaaagatcggg
gagctgcaggagaagctggcagagctcaaggagacggtggaccagaaaacgagagaagcc
gaggcccttcaggagcagcgggaccagtactacggccaccttcagcagtacacggccgcg
taccagcacctcgccagcgagaaggaggagctgcacaaacagtacctcctccagacacag
ctcatggaccgcctgcagcacgaggaggtccagggcaaagtgacggcagaggtgcacttc
aaagagctgcaggaggccaaggaaagcctggaggtagttgccaaagaaaacaaagagctg
caggcccatgtcagccagctcatggccgaactggatgcaaagatgttgcccagggcagaa
ggggatggcgtggaaactgaagaggagactgtggaggacatgaagacctcactcatcatc
ccagaggagtttgaagacagagaagagatggttgcgttcttgacgtcttccgtgtcccaa
gtggagcaggagcgtgaggagatgcggcagcagctggctgagcagaagaggcagtgcaga
ggcctcctgcaggagatagctgcactgaggaaagagcagcagctgcacgttgcgtcagga
gcaccaggtcctgctgcagattcggttccaggagaggttcacgaagccttaaagagtgcc
atggagaagctgcagtcccgtttcacagagttgatgcgtgagaaggcagagctgaaggac
cgggtggaggagctggagcaccgctgcattcagttgtctggagaaacagacaccatcggt
gaatatattgccctgtaccagagtcagagggctattctaaagcagcggcaccgggagaaa
gaggagtacatcagcagactggctcaggacaaggaggagatgaagatgaagctactggag
ctccaagagctggtgatgcgattggtcggtgagcggaatgaatggtacacaaagtacacg
agggtggctcagaacctggagccgaaacccggcccagggagcgaggccgcggtcaccctg
gagaggcgtcttgagctggatgctacggatggtgaaggactgcgggaagtgagtttgaca
gatgagccagagcaggagatggcagttcctgcctcccatcggttccacgctgatgacaaa
ggtcccccgcctgctcctcacgaccccaccgccaagcagatcatgcagcttctgcgtgaa
atccaaaatccccgagagaggctgggctccctcttggagaacccctgcattcccttcttc
taccgggctgacgagaacgacgaagtcaagatcatggtggtttaa

DBGET integrated database retrieval system