KEGG   Gekko japonicus: 107114171Help
Entry
107114171         CDS       T04299                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gja  Gekko japonicus
Pathway
gja04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gja00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107114171 (SOD1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107114171 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107114171
NCBI-ProteinID: XP_015271096
LinkDB All DBs
Position
Un
AA seq 155 aa AA seqDB search
MATLKAVCVLTGETQVKGVVHFEQKANGPVFISGHIDCLTPGKHGFHVHEFGDNTNGCTS
AGAHFNPENKTHGGPEDAVRHVGDLGNVTADASGVAKLAMQDDIISLSGPHSIIGRSMVV
HEKEDDLGRGGNEESLKTGNAGARLACGVIGLTKA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctgaaggctgtgtgtgtcttgaccggagagacccaagtcaagggcgtcgtt
cactttgagcagaaggctaatggaccagtatttatttcaggacatattgactgtttgact
ccaggaaaacatggatttcatgtccatgaatttggagacaacacaaatggatgtaccagt
gcaggtgctcacttcaatcctgagaacaaaacacatggtgggccagaggatgcagtgagg
catgttggggatctgggaaacgtgactgcagatgcctcaggtgtggcaaaattggcaatg
caggatgatataatttctctctcaggaccacattcaattattggacgttccatggtggtt
catgagaaagaagatgacttgggtagaggaggaaatgaagaaagtttgaagactggaaat
gctggtgctcgtctagcttgtggtgtgattggccttactaaggcatag

DBGET integrated database retrieval system