KEGG   Gekko japonicus: 107114224
Entry
107114224         CDS       T04299                                 

Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04137  Mitophagy - animal
gja04140  Autophagy - animal
gja04141  Protein processing in endoplasmic reticulum
gja04210  Apoptosis
gja04217  Necroptosis
gja04310  Wnt signaling pathway
gja04510  Focal adhesion
gja04530  Tight junction
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04910  Insulin signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107114224
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107114224
   04012 ErbB signaling pathway
    107114224
   04310 Wnt signaling pathway
    107114224
   04068 FoxO signaling pathway
    107114224
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107114224
   04137 Mitophagy - animal
    107114224
  09143 Cell growth and death
   04210 Apoptosis
    107114224
   04217 Necroptosis
    107114224
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107114224
   04530 Tight junction
    107114224
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107114224
   04621 NOD-like receptor signaling pathway
    107114224
   04622 RIG-I-like receptor signaling pathway
    107114224
   04625 C-type lectin receptor signaling pathway
    107114224
  09152 Endocrine system
   04910 Insulin signaling pathway
    107114224
   04920 Adipocytokine signaling pathway
    107114224
   04912 GnRH signaling pathway
    107114224
   04914 Progesterone-mediated oocyte maturation
    107114224
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107114224
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107114224
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107114224
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107114224
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like RIO1 APH Kdo FTA2
Other DBs
NCBI-GeneID: 107114224
NCBI-ProteinID: XP_015271150
LinkDB
Position
Un
AA seq 350 aa
MKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQML
CGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEV
ILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTV
RNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEAL
QHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQP
SPSGAAVNSSDSLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaagtgtgtgaaccacaaaaatattatcagtttattaaatgtcttcacaccacagaaa
tcgctggaggaattccaggatgtttatttagtaatggagctgatggatgccaacttgtgc
caggtgattcaaatggagctagatcacgagcgaatgtcttacctgctgtaccaaatgctt
tgtggcatcaagcaccttcattccgcaggaatcatacacagggatttaaaaccaagtaat
attgtggtaaaatctgactgcacattgaagattctggattttggactggccaggacagcg
ggcactagcttcatgatgactccatatgtggtcacgcgttattacagagcaccagaggtc
atcttgggaatgggctacaaggagaatgtggatatatggtcagtaggatgcattatggga
gaaatggtgcgccacaaaatcctctttccaggaagggactatattgaccagtggaataag
gtaatcgaacagctgggaacaccttgcccggaattcatgaagaaactccagcccacagtg
cggaactacgtggaaaaccgacctaaatacgccggcctaactttccccaaactcttccca
gactctctctttccagccgattcagaacacaacaaactcaaagctagccaagccagggac
cttttgtcaaagatgctagtgattgacccagccaagcggatatcagtggacgaagccttg
cagcatccgtacattaatgtttggtatgacccagcagaagtggaggcgccacctccgcag
atatatgataagcagctggatgaaagagaacacacaatcgaagagtggaaagaattaatc
tacaaggaagtaatgaattctgaagaaaagactaaaaacggcgtagtaaaaggacagcct
tctccttcaggtgcagcagtgaacagcagcgacagcctccctccgtcctcatctgtcaat
gacatttcctccatgtccacagaccagaccctggcatcggacactgacagcagtttggaa
gcttctgcaggacccctcggttgttgcaggtga

KEGG   Gekko japonicus: 107119264
Entry
107119264         CDS       T04299                                 

Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04137  Mitophagy - animal
gja04140  Autophagy - animal
gja04141  Protein processing in endoplasmic reticulum
gja04210  Apoptosis
gja04217  Necroptosis
gja04310  Wnt signaling pathway
gja04510  Focal adhesion
gja04530  Tight junction
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04910  Insulin signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107119264
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107119264
   04012 ErbB signaling pathway
    107119264
   04310 Wnt signaling pathway
    107119264
   04068 FoxO signaling pathway
    107119264
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107119264
   04137 Mitophagy - animal
    107119264
  09143 Cell growth and death
   04210 Apoptosis
    107119264
   04217 Necroptosis
    107119264
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107119264
   04530 Tight junction
    107119264
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107119264
   04621 NOD-like receptor signaling pathway
    107119264
   04622 RIG-I-like receptor signaling pathway
    107119264
   04625 C-type lectin receptor signaling pathway
    107119264
  09152 Endocrine system
   04910 Insulin signaling pathway
    107119264
   04920 Adipocytokine signaling pathway
    107119264
   04912 GnRH signaling pathway
    107119264
   04914 Progesterone-mediated oocyte maturation
    107119264
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107119264
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107119264
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107119264
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107119264
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107119264
NCBI-ProteinID: XP_015277217
LinkDB
Position
Un
AA seq 384 aa
MSRGKRENNFYSVEIADSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCSEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPVDSEHNKLKAGQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MELEERTKNGVIRGQPPPLAQVQQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgagcaggggcaagcgagagaacaacttctacagtgtagagattgcagattctaccttc
accgtgctcaaacgataccagaatttgaagccaatcggttcaggcgcccagggcatagta
tgcgcagcctatgatgcagtccttgaaagaaatgttgccatcaagaagctaagtcggccg
ttccagaaccagacccacgccaaacgagcctacagagagcttgttctcatgaagtgtgtg
aaccacaaaaatataattggcctattgaatgtctttaccccccagaagtcactggaagaa
tttcaagacgtttacatagtgatggagctcatggatgcaaatctctgccaggtgattcag
atggagctggaccacgaacggatgtcttatctcctgtaccagatgctgtgcggcattaaa
caccttcactctgctggaattatacacagggatttgaaaccaagcaatatagtagtaaaa
tctgactgcactttgaagatccttgacttcggactggccagaactgcaggaaccagtttc
atgatgaccccttacgtcgtgactcgttactacagagcgccagaagtcattttggggatg
ggatacaaagaaaacgttgacatttggtcagtggggtgcatcatgggagaaatgatcaaa
ggtggtgtattatttcctggtacagaccatatcgatcagtggaataaagttattgagcag
ctcgggaccccgtgctccgaattcatgaagaagctgcaaccaaccgtcaggacgtacgtg
gagaacagacctaaatacgccggctacagttttgaaaagctcttcccagatgtccttttc
ccagttgactctgagcacaacaaactgaaggccggtcaagcgagagatctgttatctaaa
atgctggtgattgacgcgtcgaaaagaatctcagtggatgaagctctgcagcacccctac
atcaatgtctggtacgacccctcggaagcagaagcgcctcctccaaagataccggacaag
cagttagatgaacgagagcacacgatagaagaatggaaagagctgatttacaaggaagtc
atggaactggaagagagaaccaagaatggggttatacgtggacagccgcctcctttagca
caggtgcagcagtga

KEGG   Gekko japonicus: 107123710
Entry
107123710         CDS       T04299                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04137  Mitophagy - animal
gja04140  Autophagy - animal
gja04141  Protein processing in endoplasmic reticulum
gja04210  Apoptosis
gja04217  Necroptosis
gja04310  Wnt signaling pathway
gja04510  Focal adhesion
gja04530  Tight junction
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04910  Insulin signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107123710 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107123710 (MAPK9)
   04012 ErbB signaling pathway
    107123710 (MAPK9)
   04310 Wnt signaling pathway
    107123710 (MAPK9)
   04068 FoxO signaling pathway
    107123710 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107123710 (MAPK9)
   04137 Mitophagy - animal
    107123710 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    107123710 (MAPK9)
   04217 Necroptosis
    107123710 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107123710 (MAPK9)
   04530 Tight junction
    107123710 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107123710 (MAPK9)
   04621 NOD-like receptor signaling pathway
    107123710 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    107123710 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    107123710 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107123710 (MAPK9)
   04920 Adipocytokine signaling pathway
    107123710 (MAPK9)
   04912 GnRH signaling pathway
    107123710 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    107123710 (MAPK9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107123710 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107123710 (MAPK9)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107123710 (MAPK9)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107123710 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107123710
NCBI-ProteinID: XP_015282520
LinkDB
Position
Un
AA seq 423 aa
MSESKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSHARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPADEAPPPQIYDAQLEEREHAIEEWKELIYKEVM
DWEERNKNGLVKEQPSDAAVNSNTSPSQSSSINDISSMSTEQTLASDTDSSLDALTGTLE
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagcgagagtaaatgtgatagtcaattttacagcgttcaggttgcagactccacattc
actgtacttaaacgataccagcaattgaagccgattggctctggggctcaaggcattgta
tgtgctgcatttgacacagtccttggaatcaatgttgctgtaaagaagttgagtcgtccc
tttcagaaccaaacacatgcaaaacgagcttatagggaacttgtgcttctaaagtgtgtc
aatcacaaaaatataattagtttgttaaatgtattcacaccacagaagtcgctagaagaa
tttcaagatgtgtatttggttatggaactgatggatgctaacttgtgccaagttattcat
atggagctggatcatgaacgaatgtcctaccttctgtaccagatgttatgtggaatcaag
catcttcattcggctggtatcatccacagagatttaaaacccagcaatatagtcgtaaaa
tcagattgtactctcaaaatccttgactttggacttgcaaggacagcatgtactaatttc
atgatgaccccatatgtagtaacacggtattacagagcaccagaggttattcttggcatg
ggatacaaagagaatgttgatatctggtcagttggttgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcacattgaccagtggaataaagttattgaacaa
ttaggtacaccttcagcagactttatgaaaaaactacagcctactgtacgcaactatgta
gaaaacaggccaaaatatccaggtatcaaatttgaagagctcttcccagactggatattt
ccttcagaatctgaccgtgacaaactaaaaacaagtcacgctagagatttgctatcaaaa
atgctagtggtagatccagacaaacgaatatcagtagatgaagctctgcgacatccatat
atcacagtttggtatgatcctgctgacgaagcaccaccgcctcagatctatgatgcacag
ttggaagaaagagaacatgccattgaagaatggaaagaattaatatataaagaagtaatg
gattgggaagaaagaaataagaatggtttggtaaaagaacaaccttcagatgcagcagtg
aatagcaacaccagcccttcccaatcatcatctatcaacgacatttcatccatgtcaaca
gaacaaactttggcttcagatacagacagcagtcttgacgccctgacaggaacacttgaa
ggatgccggtga

DBGET integrated database retrieval system