KEGG   Gekko japonicus: 107114301
Entry
107114301         CDS       T04299                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04210  Apoptosis
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107114301
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107114301
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107114301
   04621 NOD-like receptor signaling pathway
    107114301
   04622 RIG-I-like receptor signaling pathway
    107114301
   04623 Cytosolic DNA-sensing pathway
    107114301
   04625 C-type lectin receptor signaling pathway
    107114301
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107114301
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107114301
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107114301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107114301
Protein kinases [BR:gja01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107114301
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 Spc7 Jnk-SapK_ap_N Caps_synth_GfcC Occludin_ELL ATG16 CALCOCO1 GAS
Other DBs
NCBI-GeneID: 107114301
NCBI-ProteinID: XP_015271232
LinkDB
Position
Un
AA seq 428 aa
MPKQQKEKLEEDLKALQEANKALQKEKLSLQAEICTLQQAGKISTPSGESQVKVKENGLP
AERPLEVESLQGSGDDRKSSGGDQTEQLSQKLKEAEEEKAALRQQLATAQEELSRLAARQ
QETQQQLQQVGEDKASLKAQVTSLLGELRESQSRLEASTQEKKELEERVRGAADRLQHLE
KEAEARTKQHSVQVDQLRLKVQDLESALRVERQSATEEKKKLAQLQGAYHQLFQEYDAHI
KASMENEKRSMENEKRIKVLDQQAAELSDQLQQAEEALVAKQELIDKLKEEAEQHKAIME
TVPVLKAQAEIYKTDFLAERHAREKLHEQREALLEQLAQLQRDCEKLKADSEGASRALME
EMRNRHAEMRAPASQTPYMMGAAQFHPPLAPGPRHSMAEEQPDYCCPKCQYRAPDMDTLQ
IHIMDCIL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgccgaaacagcagaaagagaagctggaggaagacctgaaggcgctccaagaagccaac
aaggccctgcagaaggagaagctttccttgcaagccgagatttgcacattacagcaagcg
ggaaagatctcaacgccctccggagagtctcaagtaaaggtcaaagagaatggtcttccg
gcagagcgccccctggaggtggagtccctgcagggttcgggggatgacagaaagagctcc
ggtggggaccagaccgagcagctttctcagaagctgaaggaggcagaggaggagaaggca
gcccttcgtcagcagctggcgactgcccaggaggagttgtcccgcttggctgcccggcag
caagagacccagcagcagctgcagcaagttggggaggacaaggcctccctgaaagcccag
gtgacctctctgctgggggagctgcgggagagccagagccgcctggaggccagcacgcag
gagaagaaggagctggaggaaagggtccgtggggctgcagaccgactgcagcacctggaa
aaggaggcggaggcccgtaccaagcagcacagcgttcaggtggaccagctgcggctgaag
gtgcaggacctggagagcgccctgcgtgtggagaggcagagtgccacggaggagaagaag
aaactagcccagctccagggggcgtatcaccagctcttccaagagtacgacgcccacatc
aaagccagcatggagaacgagaagcgaagcatggagaacgagaagcgaatcaaggtcttg
gaccagcaggccgctgaactatccgaccaactgcagcaagcggaggaggccctggtggcc
aagcaggagctgatcgacaagctgaaggaggaggccgaacagcacaaagcaatcatggag
acggtgccagtgctgaaggcgcaggcggagatctacaagacggacttcttggcggagcgt
cacgcgcgcgagaagctccacgaacagcgggaggccctgctggagcagctggcacaactg
cagcgagactgtgagaagctgaaggccgattcagagggtgccagccgggccctaatggaa
gaaatgaggaatcgccacgcagagatgcgcgccccggcttctcagacaccttacatgatg
ggtgccgcccagttccaccccccgctggccccggggccgaggcacagcatggccgaagag
cagcccgactactgctgccccaagtgccagtacagggcgccggacatggacacgctacag
atccacatcatggactgcatcctgtga

DBGET integrated database retrieval system