KEGG   Gekko japonicus: 107114906Help
Entry
107114906         CDS       T04299                                 

Gene name
COLGALT1
Definition
(RefSeq) collagen beta(1-O)galactosyltransferase 1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107114906 (COLGALT1)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107114906 (COLGALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107114906 (COLGALT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107114906 (COLGALT1)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107114906 (COLGALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 107114906
NCBI-ProteinID: XP_015272001
LinkDB All DBs
Position
Un
AA seq 611 aa AA seqDB search
MPRRGFWPCLLLALAAWSPRPAGGYFPEERWVPESPLRPPRVLLALLARNAAHSLPAALG
CIERLRHPKDRIALWVATDHNVDNTTAVLREWLVNVQSMYHSVEWRPMDLPSRSYPDEEG
PKHWSNSRYEHIMKLRQAALQSARDIWADYILFVDADNLLTNPYTLGLLIAENKTVVAPM
LDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLVDLRKEASQNLV
FYPPHPDYTWAFDDIIVFAFACRQAEIQMYVCNKEEYGSLPVPLRSHSTLRDEVESFMHV
QLEIMVKNPPVEPSRYLSVPPKVPDKMGFDEVFMINLKRRVDRRERMLWALYEQQIDCKI
IEAVDGKAMNSSQVEAMGISMLPGYKDPYHGRPLTKGELGCFLSHYKVWQEIVERGLEKS
LVFEDDLRFEIFFKRRLMNLMYDLEEEGLDWDLIYIGRKRMQVEHPEKAVPHIRNLVEAD
YSYWTLAYVISLQGARKLLDAKPLSKMLPVDEFLPVMFDKHPVTEYMEHFENRNLLAFSV
EPLLVYPTHYTGDDGYISDTETSVVWNNENVKTDWDRAKSQKMKEQQELSNEAKNSDVLQ
SPLDSTARDEL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccggggcttctggccgtgcctgctgctggcgctggcggcgtggagcccgcgg
ccggcggggggctacttcccggaggagcgctgggtgcccgagtcgccgctgcggcccccg
cgggtcctcctggcgctgctggcccgcaacgcggcgcactccctgccggcggcgctgggc
tgcatcgagcgcctgcgccaccccaaggaccgcatcgccctctgggtggcgactgaccac
aatgtggacaacacaacagctgtgcttcgggaatggctggtcaacgttcagagcatgtac
cactcagtggaatggcggcccatggacctgcccagcaggtcttacccagatgaagaaggc
cccaagcactggtcaaactcccgttacgaacatattatgaagcttcgccaagcggctttg
cagtcagcccgggacatttgggctgattacatcctgtttgtggatgctgacaacctcttg
accaacccctacaccctgggtcttttgatagccgaaaacaagacagtggtggcgccgatg
ctggattcgcgggcggcctattcaaacttctggtgcgggatgacttctcagggctattac
aagcgtacccctgcctacatccccatcaggaaacgtgaccgccggggttgctttgcggtt
cccatggtgcactctacctttctcgtcgacctgcggaaggaggcctcccaaaaccttgtc
ttctacccgcctcacccggactacacttgggcattcgatgacatcattgtctttgccttc
gcctgcaggcaggcagagatccagatgtatgtgtgcaacaaagaggagtatggctccctg
cctgtgcctctgcgatcccacagcaccctgcgcgatgaggtagagagcttcatgcacgtg
cagttggaaatcatggttaagaaccctccagtggaaccatcccggtatctctctgtgcct
cccaaagtcccggacaagatgggatttgatgaggtcttcatgattaacctgaagcgccgg
gtggatcgccgagagcggatgctgtgggccttgtatgagcagcagattgactgcaaaatc
attgaggctgtggatgggaaagccatgaacagcagccaggtggaggccatgggcatcagc
atgctgccaggttacaaggacccgtaccacgggcgtcccctcaccaagggggaattgggt
tgcttcctgagccactataaggtttggcaagagattgtggagaggggtctggagaagtcg
ctggtgtttgaggatgacctgcgttttgagatcttcttcaaaaggcgcctgatgaatctc
atgtacgacttggaggaggagggcctggactgggacttgatctacattggccggaagcgc
atgcaggtggagcatccggagaaagccgtgccccacatccgcaacctggtggaagcagat
tactcctactggacgctggcctatgtcatctccctgcagggtgcccggaagctattggat
gccaagcctctctccaagatgttacctgtggatgagttcctgcctgtcatgtttgacaaa
catcctgtcactgagtatatggagcattttgagaaccggaacttgctggccttctcggtg
gagcccctcttggtctacccgacgcattacacgggggacgacggctacatcagtgacacg
gagacctctgtggtgtggaacaatgagaacgtcaagacggactgggaccgggccaagtcc
cagaagatgaaggagcagcaggagctgagtaacgaggccaagaactctgatgtgctccag
tcccctctcgacagcacggcccgcgatgagctatga

DBGET integrated database retrieval system