KEGG   Gekko japonicus: 107114906Help
Entry
107114906         CDS       T04299                                 

Gene name
COLGALT1
Definition
(RefSeq) collagen beta(1-O)galactosyltransferase 1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107114906 (COLGALT1)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107114906 (COLGALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107114906 (COLGALT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107114906 (COLGALT1)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107114906 (COLGALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 107114906
NCBI-ProteinID: XP_015272001
LinkDB All DBs
Position
Un
AA seq 611 aa AA seqDB search
MPRRGFWPCLLLALAAWSPRPAGGYFPEERWVPESPLRPPRVLLALLARNAAHSLPAALG
CIERLRHPKDRIALWVATDHNVDNTTAVLREWLVNVQSMYHSVEWRPMDLPSRSYPDEEG
PKHWSNSRYEHIMKLRQAALQSARDIWADYILFVDADNLLTNPYTLGLLIAENKTVVAPM
LDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLVDLRKEASQNLV
FYPPHPDYTWAFDDIIVFAFACRQAEIQMYVCNKEEYGSLPVPLRSHSTLRDEVESFMHV
QLEIMVKNPPVEPSRYLSVPPKVPDKMGFDEVFMINLKRRVDRRERMLWALYEQQIDCKI
IEAVDGKAMNSSQVEAMGISMLPGYKDPYHGRPLTKGELGCFLSHYKVWQEIVERGLEKS
LVFEDDLRFEIFFKRRLMNLMYDLEEEGLDWDLIYIGRKRMQVEHPEKAVPHIRNLVEAD
YSYWTLAYVISLQGARKLLDAKPLSKMLPVDEFLPVMFDKHPVTEYMEHFENRNLLAFSV
EPLLVYPTHYTGDDGYISDTETSVVWNNENVKTDWDRAKSQKMKEQQELSNEAKNSDVLQ
SPLDSTARDEL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccggggcttctggccgtgcctgctgctggcgctggcggcgtggagcccgcgg
ccggcggggggctacttcccggaggagcgctgggtgcccgagtcgccgctgcggcccccg
cgggtcctcctggcgctgctggcccgcaacgcggcgcactccctgccggcggcgctgggc
tgcatcgagcgcctgcgccaccccaaggaccgcatcgccctctgggtggcgactgaccac
aatgtggacaacacaacagctgtgcttcgggaatggctggtcaacgttcagagcatgtac
cactcagtggaatggcggcccatggacctgcccagcaggtcttacccagatgaagaaggc
cccaagcactggtcaaactcccgttacgaacatattatgaagcttcgccaagcggctttg
cagtcagcccgggacatttgggctgattacatcctgtttgtggatgctgacaacctcttg
accaacccctacaccctgggtcttttgatagccgaaaacaagacagtggtggcgccgatg
ctggattcgcgggcggcctattcaaacttctggtgcgggatgacttctcagggctattac
aagcgtacccctgcctacatccccatcaggaaacgtgaccgccggggttgctttgcggtt
cccatggtgcactctacctttctcgtcgacctgcggaaggaggcctcccaaaaccttgtc
ttctacccgcctcacccggactacacttgggcattcgatgacatcattgtctttgccttc
gcctgcaggcaggcagagatccagatgtatgtgtgcaacaaagaggagtatggctccctg
cctgtgcctctgcgatcccacagcaccctgcgcgatgaggtagagagcttcatgcacgtg
cagttggaaatcatggttaagaaccctccagtggaaccatcccggtatctctctgtgcct
cccaaagtcccggacaagatgggatttgatgaggtcttcatgattaacctgaagcgccgg
gtggatcgccgagagcggatgctgtgggccttgtatgagcagcagattgactgcaaaatc
attgaggctgtggatgggaaagccatgaacagcagccaggtggaggccatgggcatcagc
atgctgccaggttacaaggacccgtaccacgggcgtcccctcaccaagggggaattgggt
tgcttcctgagccactataaggtttggcaagagattgtggagaggggtctggagaagtcg
ctggtgtttgaggatgacctgcgttttgagatcttcttcaaaaggcgcctgatgaatctc
atgtacgacttggaggaggagggcctggactgggacttgatctacattggccggaagcgc
atgcaggtggagcatccggagaaagccgtgccccacatccgcaacctggtggaagcagat
tactcctactggacgctggcctatgtcatctccctgcagggtgcccggaagctattggat
gccaagcctctctccaagatgttacctgtggatgagttcctgcctgtcatgtttgacaaa
catcctgtcactgagtatatggagcattttgagaaccggaacttgctggccttctcggtg
gagcccctcttggtctacccgacgcattacacgggggacgacggctacatcagtgacacg
gagacctctgtggtgtggaacaatgagaacgtcaagacggactgggaccgggccaagtcc
cagaagatgaaggagcagcaggagctgagtaacgaggccaagaactctgatgtgctccag
tcccctctcgacagcacggcccgcgatgagctatga

KEGG   Gekko japonicus: 107117514Help
Entry
107117514         CDS       T04299                                 

Gene name
COLGALT2
Definition
(RefSeq) collagen beta(1-O)galactosyltransferase 2
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107117514 (COLGALT2)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107117514 (COLGALT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107117514 (COLGALT2)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107117514 (COLGALT2)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107117514 (COLGALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4
Motif
Other DBs
NCBI-GeneID: 107117514
NCBI-ProteinID: XP_015275137
LinkDB All DBs
Position
Un
AA seq 515 aa AA seqDB search
MYHYVEWRPMDDPQSYPDEIGPKHWPNSRFTHVMKLRQAALRTAREKWSDYIMFIDADNF
LTNPEVLNLLIAENKTIVAPMLESRTLYSNFWCGMTPQGYYKRTPDYVLIREWKRAGCFA
VPMVHSTFLIDLRKEASDQLMFYPPHQDYTWSFDDIIVFAFSSRQAGIQMYICNREHYGF
LPVPLKPHQMLEEDTDNIVHVLIEAMIDRPAIEPSDYITVPPKHPDKMGFDEIFMINLKR
RKDRRDRMLRTLYEQEIAVKLVEAVDGKALNTSQLKALNIDMLPGYRDPYSSRVLTRGEI
GCFLSHYYIWKEVVDREMEKTLVIEDDVRFEHQFKKKLTKLMDDIEKAQLDWELIYIGRK
RMQVERPEKAVPNVMNLVEADYSYWTLGYAISLQGAQKLIDAQPFGKMLPVDEFLPVMYN
KHPVAKYMEYYEPRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTL
SRKSRQQGQIHTDAQNKDALAPQPSLDASSPRDEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtatcactatgtggagtggaggccaatggatgaccctcagtcttatcctgatgagatt
gggcccaaacactggccgaactccaggtttacccatgtgatgaagctgcgccaggcggct
ttgagaactgccagagaaaaatggtctgactacatcatgttcatagatgccgacaacttc
ctgacaaacccagaagttctgaatctgttgatagcagagaacaagaccattgtggcaccc
atgcttgaatcacgcaccctctactcaaacttctggtgtggaatgactcctcagggctac
tacaagaggacaccagattatgtcctgatcagggaatggaagagggctggttgctttgct
gttccgatggtccactccacgtttctgatagatctcagaaaagaggcctcagatcagctg
atgttttatccgccacatcaggactatacatggagctttgatgacatcattgtctttgcc
ttctccagtcgccaagcaggcattcagatgtacatctgcaacagagaacattatgggttc
ctccctgtgcccctgaagcctcaccagatgctggaggaggacacggacaacattgttcat
gtgctgatagaggcaatgattgaccgtccagccattgaaccttctgactatatcaccgtt
cctccaaagcacccagacaagatgggatttgatgagattttcatgataaatctgaaacgt
cggaaggacaggcgagaccgaatgttacgaacattgtatgagcaggaaattgcggtcaag
ctggtagaagctgtagatggaaaggccctgaacacgagccaactcaaagccctcaacata
gacatgcttcctggttaccgggatccttactcctcgagggtactgaccagaggggagatt
ggctgcttcctgagccactactacatatggaaggaggtggtggacagggagatggagaag
accctggtcattgaagacgacgtgcgctttgagcatcagttcaagaagaagctcacaaag
ctgatggacgacatcgagaaagcccagctcgactgggaactcatttacattggccggaaa
cggatgcaagtggagcgtcccgagaaggctgttcccaacgtcatgaaccttgtggaagcc
gattactcttattggacgctcggctacgccatctccttgcagggggctcagaaattgatt
gacgctcagccgttcggcaagatgttgccagtggatgaattcctgccggtcatgtacaac
aagcacccagttgccaagtacatggagtactatgaaccaagagacctaaaagccttctcc
gcagagcctctgctgatctatcccacccattacactgggcagccaggttacctcagtgat
accgagacctccaccatctgggacaacgagaccgtggccacagactgggacagaacgctc
tctcggaaatcacggcagcaggggcagattcacacagatgcccagaacaaggatgccttg
gcccctcagccctcactggatgcgtcgtctccgagggacgaactatga

KEGG   Gekko japonicus: 107118151Help
Entry
107118151         CDS       T04299                                 

Gene name
PLOD3
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107118151 (PLOD3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107118151 (PLOD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107118151 (PLOD3)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     107118151 (PLOD3)
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107118151 (PLOD3)
    2.4.1.66  procollagen glucosyltransferase
     107118151 (PLOD3)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107118151 (PLOD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anp1 2OG-FeII_Oxy 2OG-FeII_Oxy_3
Motif
Other DBs
NCBI-GeneID: 107118151
NCBI-ProteinID: XP_015275912
LinkDB All DBs
Position
Un
AA seq 722 aa AA seqDB search
MAEWKFRPESNSPVMWASKGKLLVLTAATEETEGYQRFLRTTKYFNYTVKTLGLGEDWKG
GDVARTVGGGQKVRWLKAEMKKYVNEEDLIVMFVDSYDVILAGGPVELLQKFQQFDSNLV
FSAESFCWPEWSLAEKYPPVAVGNRFLNSGGFIGYASVINRVVQLWKYKDDDDDQLFYTR
IYLDPALREKYGITLDHKSKIFQNLNGAIEEVVLKFEPIRVRARNVAYDTLPVVIHGNGP
TKLQLNYLGNYIPNVWTYEGGCEVCDQGLLDLSSLADDSYPHVLIGVFIEQPTPFLPEFL
QRLLTFDYPYSRLSLFIHNREVYHEQHIQAEWEHLQGAFDSIKLVGPEEEMSEGEARDMA
MDLCRQDLACGYYFSLDADVVVVNPEILQILIQDNKKVIAPMMSRHGKLWSNFWGALSPE
GYYARSEDYVELVQGKRIGVWNVPYISQAYLLRGETLRSELVQQHVFTLDDMDPDMAFCK
SVREKGIFLHISNRDEFGRLLSTASFNTSRLHPDLWQIMENPLDWQEKYIHENYSQVLEG
ESHMQPCPDVYWFPVFTDQMCDELVEEAENFGQWSGGKHEDTRLAGGYENVPTVDIHMNQ
IGFEKEWLRFLQEYIAPVTEKLYPGYYTKARAIMNFMVRYRPDEQPFLRPHHDSSTFTIN
IALNHKGVDYQGGGCRFIRYNCTVESPRKGWSLMHPGRLTHYHEGLPTTSGTRYIMVSFV
DP
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtggaagttcagacctgaaagcaacagcccggtgatgtgggctagcaaaggg
aagctgctggtactgacggcagccacggaggagacggaagggtaccagcgcttcctacga
acaaccaaatacttcaactacacggtcaagactcttggcctaggggaggactggaaggga
ggggatgttgcccggacggttggcggagggcagaaagtccgctggctgaaggcagaaatg
aagaagtatgtcaatgaggaagacctgatagtcatgtttgtggacagctatgacgtgatc
ctggccggcggccccgtcgaacttctgcagaagttccagcagttcgacagcaacttggtc
ttctcggcggaaagcttctgctggccggagtggtcgctggcggaaaagtaccccccagtg
gctgtgggaaaccggtttctcaactccggaggattcattggctatgcttccgtcatcaat
cgcgttgtccagctatggaagtacaaggatgacgacgacgaccagctcttctacacgcgt
atttacttggatcctgccttgcgggagaaatatgggatcaccctggatcacaagtcaaaa
atctttcagaacctgaatggcgccattgaggaagtcgttctgaagttcgaaccgatccgg
gtgcgtgcccgaaatgtcgcctacgacaccctacctgttgtcatccatggcaatggccct
accaagctgcagctgaactacctggggaattacatccccaatgtctggacatacgagggg
ggttgtgaagtgtgtgaccaaggactcctggacctgtcaagcttggcggacgactcctat
ccccacgtgctcattggcgtgttcatcgagcagccgactcccttcctgcctgagttcctt
cagcgtctcctgacctttgattacccttactctcgcctcagcctcttcatccacaaccgg
gaggtgtatcacgagcagcacatccaggccgagtgggagcaccttcagggggccttcgac
agcatcaagctcgtgggtccagaggaggaaatgagtgagggcgaggccagagatatggcc
atggacctctgccgccaggaccttgcctgtggctattacttcagcctggatgccgacgtg
gtcgtggtgaaccccgagatcctgcagattctcatccaggataacaagaaggtgatcgct
cccatgatgtcccggcatggaaagctctggtccaatttctggggggccctgagccccgaa
ggatactacgcccgctcggaggactacgtggaactggtgcagggcaagaggataggtgtg
tggaacgtcccttacatctcccaggcttacttgctgaggggggagacgttacgcagcgag
ctggtccagcagcacgtcttcactttggacgacatggacccggatatggctttctgcaag
agtgtgcgggaaaagggtatcttccttcacatcagcaaccgggacgagttcgggcgtctc
ctttccaccgccagcttcaacacatcccgtctgcatccggacctctggcagatcatggag
aaccccctggactggcaggagaaatacatccatgagaattactcacaagtgctggagggg
gaaagccacatgcagccgtgccctgacgtttactggttcccagtgttcaccgaccagatg
tgtgatgagctggtggaagaggctgaaaactttggccagtggtcgggggggaagcacgag
gacaccagactggctggcggctacgagaacgtcccgactgtcgatatccacatgaatcaa
attggctttgagaaggagtggctccggttcctacaagaatacatcgcgcccgtcacagag
aagctctatcctggctactacaccaaggctcgggcaatcatgaacttcatggtccggtac
cgacctgatgagcaacccttcctccgtccacatcacgattcatccactttcaccatcaat
attgctctcaaccataaaggagtggactatcagggcggaggctgccggtttatccgctac
aactgcactgtggaatccccccgcaagggctggagcttgatgcaccccggacgcctcact
cactaccacgaaggactgcccacgaccagtggcacccgctacatcatggtctcttttgtg
gacccctaa

DBGET integrated database retrieval system