KEGG   Gekko japonicus: 107115197
Entry
107115197         CDS       T04299                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
gja  Gekko japonicus
Pathway
gja04012  ErbB signaling pathway
gja04140  Autophagy - animal
gja04210  Apoptosis
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04910  Insulin signaling pathway
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107115197 (BAD)
   04370 VEGF signaling pathway
    107115197 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107115197 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    107115197 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107115197 (BAD)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107115197 (BAD)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107115197 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 107115197
NCBI-ProteinID: XP_015272323
LinkDB
Position
Un
AA seq 150 aa
MFHIPEYQEDEAAFPAEEKELLDHKLNWRGIEGEGKEPDSLAHTGTTSTGPQAELRRRIG
SDPPLPESEPPDEVGTFRGRSRSAPPILWAAQRYGRELRRMSDEFHGALQKLPRPKSAGT
ASQMFRTSGWKETLHSWWRRSSPGLPRSPP
NT seq 453 nt   +upstreamnt  +downstreamnt
atgttccacattcctgagtaccaggaggatgaggccgctttcccagcagaggagaaagaa
ctgctggaccacaagctgaactggcggggaattgagggagagggcaaggagccggacagt
ttggcgcacactgggaccacttccaccgggccccaagcagagctgcggcgtcgcattggc
tcagaccccccgttgccagagtcagagccaccagatgaggtgggcactttccgggggcgt
tcacgctctgcccctcccatcctgtgggcggcccagcgatacggacgggaactgcggagg
atgagtgatgagttccacggggcactgcagaagctgccacgacccaagagcgcagggact
gcctcacagatgttccgaacgtcaggctggaaggagaccctgcattcatggtggcgccga
agttccccgggacttcccagaagtcctccctga

DBGET integrated database retrieval system