KEGG   Gekko japonicus: 107115220
Entry
107115220         CDS       T04299                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04137  Mitophagy - animal
gja04210  Apoptosis
gja04218  Cellular senescence
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107115220 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107115220 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    107115220 (RELA)
   04218 Cellular senescence
    107115220 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107115220 (RELA)
   04621 NOD-like receptor signaling pathway
    107115220 (RELA)
   04622 RIG-I-like receptor signaling pathway
    107115220 (RELA)
   04623 Cytosolic DNA-sensing pathway
    107115220 (RELA)
   04625 C-type lectin receptor signaling pathway
    107115220 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107115220 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107115220 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107115220 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107115220 (RELA)
Transcription factors [BR:gja03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107115220 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107115220
NCBI-ProteinID: XP_015272351
LinkDB
Position
Un
AA seq 566 aa
MGDHLAPISTAFSSPTMDDLLPLIFQQNWGLQDSTPSTPFVEIIEQPKQRGMRFRYQCEG
RLAGSIPGERSTDTTKTHPTIKIHNYVGPGKVRISLVTKETPHRPHPHDLVGKDCKEGFY
EAELASERSIHSFQNLGIQCVRKRDLEKAIAKRIETNNNPFSVPLEELKGDYDLNAVRLC
FQVWIRDAASGHLVQLPLTVSQPIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKV
QKEDIEVRFFKDSWEAKGSFSQADVHRQVAIVFRTPPYMDQTLREPVMVQMQLRRPSDKE
VSGPMEFRYLPDEGDFHRIEEKRKRTLGTFKNFVQKAPFAVNLPESRSPRRIAVPKHGSP
RPNTSGVPGLLGAPGQLPSSITKPQTMPQPSSGFSFSGPSHVRPPATAMQPDFSTVNLED
LSGLGVSQRVQHSESEAETSIADAILHLHFEGGDGGAMELSGLLDDAPYTSLEGINTTEF
HQLLTEGHAPTSLPDNQGTLLTYPESITRLVSQRRAEGEAGDGNGGGGGGSSASSFVNGI
LGTLPGEDSFSMVDLDLNSLLSQLNS
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgggggaccatttggcccctatctcgaccgccttctcctctccgaccatggacgatctt
ctcccactgatctttcagcaaaactggggtcttcaggactccacccccagcacgcctttt
gtggagatcattgaacagcccaagcagcggggcatgcgtttccgttaccagtgcgaagga
cgcttggctggctccattcctggggaacgcagcacagacaccacgaagacacaccccacc
atcaagatccataactatgtgggtccaggcaaggtccgcatctccctggtgaccaaggaa
actccccaccggccccacccccatgacctggtgggaaaagactgcaaagaaggcttctac
gaggcagagctggcatcagagcgctccatccacagtttccagaacttggggatccagtgt
gtgcggaaacgagacctggagaaagctatagccaagcggatcgaaaccaacaacaatcct
ttcagtgtgcccctggaagaactaaaaggagattacgacctgaatgctgttcggctctgt
ttccaggtgtggattcgagacgcagccagcggtcacttggttcagctgcccttaactgtg
tcgcagccaatctatgacaatcgtgcccccaacacagctgagctgaagatctgccgtgtg
aaccgtaactcagggagctgcttggggggagacgagattttccttctctgtgacaaagtg
cagaaagaggacattgaagtccgctttttcaaggattcctgggaagcaaagggctccttc
tctcaagctgacgtccaccgccaagtggccattgtcttcaggacccccccttacatggac
caaaccctccgtgagccagtgatggttcagatgcagctgcgccgcccatcagacaaggaa
gtcagtggccccatggagttccgctacctcccagatgaaggtgatttccatcgcatcgag
gagaaacgcaaacggacgcttgggaccttcaagaactttgtgcagaaggcgccctttgca
gtcaaccttccagaatcccgctccccacgccgcatcgctgttccaaagcatggctcaccc
cggcctaacaccagcggtgttccagggctcttgggagctccagggcaactcccatcgtct
attacaaaaccacagaccatgccccagccttcctcgggcttctccttctctgggcccagc
catgtccgtcctccagcgactgccatgcagcccgacttcagcacagtaaacttggaagat
ctgtccggcctgggtgtgtcccagagggtccagcactccgagtcagaggcggagaccagc
attgcagacgcaatcctgcaccttcactttgagggaggagacgggggagccatggagctc
agtgggctcttggatgacgccccctacaccagcttggaggggatcaacacgacagaattc
catcagctcctcacggaggggcacgcccccacatcgctcccagacaaccagggcactctg
ctcacttaccccgagtccatcacacgcctggtgagccagcggcgggcagaaggggaggct
ggcgatggcaatggtggcggtggagggggcagctcggccagcagcttcgtcaatggcatt
ttggggacccttccaggtgaagacagcttctccatggtggacctggacttgaactctctc
ctgagccagctgaattcataa

DBGET integrated database retrieval system