KEGG   Gekko japonicus: 107115252
Entry
107115252         CDS       T04299                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04114  Oocyte meiosis
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04270  Vascular smooth muscle contraction
gja04350  TGF-beta signaling pathway
gja04370  VEGF signaling pathway
gja04371  Apelin signaling pathway
gja04510  Focal adhesion
gja04520  Adherens junction
gja04540  Gap junction
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04916  Melanogenesis
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107115252 (MAPK1)
   04012 ErbB signaling pathway
    107115252 (MAPK1)
   04350 TGF-beta signaling pathway
    107115252 (MAPK1)
   04370 VEGF signaling pathway
    107115252 (MAPK1)
   04371 Apelin signaling pathway
    107115252 (MAPK1)
   04068 FoxO signaling pathway
    107115252 (MAPK1)
   04150 mTOR signaling pathway
    107115252 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107115252 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107115252 (MAPK1)
   04210 Apoptosis
    107115252 (MAPK1)
   04218 Cellular senescence
    107115252 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107115252 (MAPK1)
   04520 Adherens junction
    107115252 (MAPK1)
   04540 Gap junction
    107115252 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107115252 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107115252 (MAPK1)
   04621 NOD-like receptor signaling pathway
    107115252 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    107115252 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107115252 (MAPK1)
   04912 GnRH signaling pathway
    107115252 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    107115252 (MAPK1)
   04916 Melanogenesis
    107115252 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107115252 (MAPK1)
   04270 Vascular smooth muscle contraction
    107115252 (MAPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107115252 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107115252 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107115252 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107115252 (MAPK1)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107115252 (MAPK1)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107115252 (MAPK1)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107115252 (MAPK1)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107115252 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 Kdo NDUF_B4 Kinase-like
Other DBs
NCBI-GeneID: 107115252
NCBI-ProteinID: XP_015272395
LinkDB
Position
Un
AA seq 263 aa
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPYKNKVPWNR
LFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPSDEPVAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaagatgtatacattgtgcaagatctcatggagacggacctttacaagctcttaaag
actcaacatctcagcaacgaccacatctgttatttcctttaccagatcctgagaggatta
aaatatatccattctgccaatgtgctgcatcgtgacctcaaaccttccaacttgctgcta
aacaccacttgtgatctcaagatctgtgattttggattggctcgtgtagcagatccagat
cacgaccatactggcttcttgacagaatatgtagccacacgttggtacagagctcctgag
atcatgttgaattctaagggttacaccaaatctattgacatctggtctgtaggctgtatt
ttggcagagatgctgtcaaacagacccatctttccaggaaagcactaccttgatcagctg
aaccatatccttggaatacttggatctccttcccaagaagacttgaattgtataatcaat
ttgaaagccagaaattatttgctttctttaccatacaaaaacaaggtgccatggaacagg
ctgtttcccaatgctgaccccaaagctcttgatttgttggataaaatgttaaccttcaac
cctcataagagaattgaagtagaagaagctttggctcatccatatctagagcaatattat
gacccaagcgatgagcctgtagctgaagcacccttcaagtttgacatggagttggatgat
ttgccgaaggaaaaactgaaagaactaatttttgaggagactgcccgattccagccagga
tacagatcttaa

KEGG   Gekko japonicus: 107117455
Entry
107117455         CDS       T04299                                 

Gene name
MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04114  Oocyte meiosis
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04270  Vascular smooth muscle contraction
gja04350  TGF-beta signaling pathway
gja04370  VEGF signaling pathway
gja04371  Apelin signaling pathway
gja04510  Focal adhesion
gja04520  Adherens junction
gja04540  Gap junction
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04916  Melanogenesis
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107117455 (MAPK3)
   04012 ErbB signaling pathway
    107117455 (MAPK3)
   04350 TGF-beta signaling pathway
    107117455 (MAPK3)
   04370 VEGF signaling pathway
    107117455 (MAPK3)
   04371 Apelin signaling pathway
    107117455 (MAPK3)
   04068 FoxO signaling pathway
    107117455 (MAPK3)
   04150 mTOR signaling pathway
    107117455 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107117455 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107117455 (MAPK3)
   04210 Apoptosis
    107117455 (MAPK3)
   04218 Cellular senescence
    107117455 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107117455 (MAPK3)
   04520 Adherens junction
    107117455 (MAPK3)
   04540 Gap junction
    107117455 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107117455 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107117455 (MAPK3)
   04621 NOD-like receptor signaling pathway
    107117455 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    107117455 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107117455 (MAPK3)
   04912 GnRH signaling pathway
    107117455 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    107117455 (MAPK3)
   04916 Melanogenesis
    107117455 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107117455 (MAPK3)
   04270 Vascular smooth muscle contraction
    107117455 (MAPK3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107117455 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107117455 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107117455 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107117455 (MAPK3)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107117455 (MAPK3)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107117455 (MAPK3)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107117455 (MAPK3)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107117455 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 NDUF_B4 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 107117455
NCBI-ProteinID: XP_015275062
LinkDB
Position
Un
AA seq 376 aa
MAAAAATAAPGGAGPVPVPGAPRLGVETVKGQVFDVGPRYTDLQYIGEGAYGMVCSSYDH
VNKIRAAIKKISPFEHQTYCQRTLREIKILLRFKHENVIGINDILRAPTIDQMRDVYIVQ
DLMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKI
CDFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNR
PIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQKPKVPWSRLFPKADPK
ALDLLDKMLTFNPNKRITVEESLAHSYLEQYYDPSDEPVAEEPFTFDMELDDLPKERLKE
LIFEETARFQPGYQGP
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcggcagcggcggcaacagcggccccgggtggggcaggccccgtgcccgtaccagga
gctccgcggctgggagtggagacggtgaagggtcaagtttttgatgtggggccgcgttac
acggatctacagtacatcggcgagggggcgtacggcatggtctgttcttcctacgatcat
gtcaacaagatccgggctgccatcaaaaagatcagtccctttgagcaccagacgtactgc
cagcgcacgctgcgtgagatcaagatcctcttgcgcttcaagcatgagaatgtcatcggc
atcaatgacattctgcgtgcacctaccatcgatcagatgcgtgatgtatatatagttcag
gatttgatggagaccgatctctataagctgctgaaaactcagcagctcagcaatgatcat
atctgctacttcctctatcagattctccgagggctgaaatacattcactctgccaatgtg
cttcaccgggacctgaagcccagcaacctcctcataaacaccacgtgtgacctaaagatc
tgtgattttggcctggcccggattgctgatccagaccatgaccacacgggtttcttgaca
gagtacgttgccactcgctggtaccgtgctcctgaaatcatgcttaattcaaagggctac
accaagtccattgatatatggtctgtgggctgcatcctggccgagatgctgtcgaaccga
cccatctttcctggcaagcactacctggaccagctcaaccacatcctgggcattctgggt
tccccatctcaagacgatctgaactgcatcatcaacatgaaggctcgaaactatctccag
tctctgccccaaaagcccaaggttccatggtctagactcttccccaaggctgatcccaaa
gcactggacctgctggacaaaatgttgacctttaacccaaacaagcgcatcacagtggaa
gagtcactggcccattcttacctagagcagtactacgacccctcagatgagccagttgct
gaggaaccgttcacctttgatatggagctggacgacctgcccaaagagaggctgaaagaa
ctgatatttgaggagacagcacgattccagcctggctaccaagggccttga

DBGET integrated database retrieval system