KEGG   Gekko japonicus: 107115324
Entry
107115324         CDS       T04299                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
gja  Gekko japonicus
Pathway
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107115324 (IKBKE)
   04621 NOD-like receptor signaling pathway
    107115324 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    107115324 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    107115324 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    107115324 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107115324 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107115324 (IKBKE)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     107115324 (IKBKE)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107115324 (IKBKE)
SSDB
Motif
Pfam: Pkinase TBK1_ULD PK_Tyr_Ser-Thr TBK1_CCD1 Pkinase_fungal APH Kinase-like RIO1
Other DBs
NCBI-GeneID: 107115324
NCBI-ProteinID: XP_015272494
LinkDB
Position
Un
AA seq 448 aa
MKSTPNYLWETEDVLGQGATASVYKARNKVSGELVAVKVFNNASYLRPQEVQMREFEVLR
KLNHQNIVKLFAVEEIESSKQKVLVMEYCSGGSLLTLLEEPENAFGLSESEFLIVLHCVV
SGMNHLRENGIVHRDIKPGNIMRLIGEDGQSVYKLTDFGAARELEDDEKFVSVYGTEEYL
HPDIYKRAVLKKPQQRAYGATVDLWSIGVTFYHAATGSLPFIPFGGPRKNKEIMYKITTE
KPTGAIAGIQQQENGTIDWTYELPITCRLSLGLKRLLVPILANVLEADQEQCWGFDQFFA
ETNDILHRTIILVFCLPQAAMHWVFIHSYNTAAIFLEEVFQETNIVGHHQEYFFEGHSYA
LEPSLQAHNFPRTTENCPLIMLSTELEDPVVLRYRDPALEYPKFLPQVDVLADCSTAKDV
VSATYYTVRVARSLLQCQELVLRGLYWV
NT seq 1346 nt   +upstreamnt  +downstreamnt
atgaaaagtacaccaaactatctctgggaaacagaagatgtgctgggtcaaggggccact
gccagtgtgtacaaagcccgcaacaaggtatcaggagaactagttgctgttaaagtcttc
aacaatgccagttacctgagacctcaggaggtacagatgagagaatttgaagtcctaagg
aagttaaaccaccaaaacattgtcaaactctttgctgtggaagaaattgaaagcagcaaa
cagaaagtgctggtaatggagtactgctcaggtgggagcctgctgaccttgttagaagaa
ccagaaaatgcctttggcttgtcagaatccgagttcctcatagtgttacactgtgtagtg
tctggcatgaatcatcttcgtgagaatgggattgttcacagggatatcaaaccaggaaac
atcatgcgtctcattggagaagacggacagagtgtttacaagctgactgattttggagct
gcccgcgaactggaggatgatgaaaagtttgtgtcagtttatgggacagaagaatatctt
cacccagatatatataagcgagctgtgctgaagaagccccagcagagggcttatggggca
actgtagatctgtggagtattggggtaaccttttaccatgcagccacaggcagcctcccg
tttatcccttttggaggacctcgcaagaacaaggaaataatgtacaaaataacaactgag
aagcccactggagctatcgcaggcatccaacaacaagagaatgggaccattgactggacc
tatgagctaccaatcacatgccgactttctcttggactgaaaagactacttgtccccatc
ctcgcaaacgttttggaggctgatcaagagcagtgctggggctttgaccagttttttgca
gaaaccaatgacatcctgcaccggacgataatccttgtcttctgtttgccacaagctgcc
atgcactgggtcttcatccactcctataacacagctgccatatttctagaagaagtcttc
caggaaacaaatatagttggccaccaccaggagtacttctttgagggacactcatatgca
ttggagcccagtcttcaggctcataatttccccaggaccacagaaaactgtcctctgatc
atgctgagcacagaactggaagatccagtggtgctgaggtacagagatccggctttagag
tacccaaagtttctcccccaagtcgatgtcttagcagattgcagtacagcaaaggatgtt
gtgagtgcaacttactacaccgtgagggtagcaaggtcacttctgcagtgccaggaactg
gttctcagaggcttgtattgggtgag

DBGET integrated database retrieval system