KEGG   Gekko japonicus: 107115893Help
Entry
107115893         CDS       T04299                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107115893 (SETD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107115893 (SETD1B)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107115893 (SETD1B)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107115893 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     107115893 (SETD1B)
    COMPASS/SET1 complex (yeast)
     107115893 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 107115893
NCBI-ProteinID: XP_015273155
LinkDB All DBs
Position
Un
AA seq 2006 aa AA seqDB search
MSFKEIKAGEKAKHTEDHGKKQSSSWINGMESSSQASTSAEKRNHHCKSYKLIIDPALKK
GQHKLYRYDGQHFNIPNSGLAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPP
KQVTFAKLNDNIRENFLLDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQ
HLHNTSVMGNIIHVELDTKGEKRMHFYELLVNGLYTPQTLPVENEPDASPTVNETLQLAD
TLKRLKDSSLSSVGSSVTPNSSTPFSHDTAFSSCRQDTPNSFSQFTPQSQGTPLTPRVGT
PFSQDSAYSSRQTTPSYHFRQDSGYKPRRHETKFTDAYNRRPGHHYVHNSAGAFRGSEHQ
FSTFKSHQQETVQYSHTPPLSHSGSSTYKSAFSPYQAPTTFPQPEEPPLPQASREVEYQR
PPLPPEESPVKSSTATTPEFVPVKEKPEEPPPLPESNSLSEPAVVPFSQTPERSETPGTP
TLESDVQHNSLDSRIEMLLKEQRTKLYFLSEHDSDNEIRMEGSPISSSSSQLSPIATFGS
SSQPGHRPQTPSSRPSSTGLEDISPTPLPDSDDDEPVLGTASLCQNSRGTSDTSMTPVDQ
LCRTSKTESSETKEMLPGNQSPVSEKMDECHQSSGEDMEISDDEMNQSPITSAECAKNIV
MNTSVNSSAVMAPSIPMPPPGYPPLPPPPPHQPGFPMPPPLPPPPPPPTHTTVTVPPPPL
PAPPGVPPPHILPPLPPFMFPVMQMDMISVLSNQWGGMSMSFQMQTQMLSRMMQGHNTYQ
YHPFMGNRMQFVNLPPYRHFSMGAAIGRGQPWPPLPKFDPSVPPPGYEPKKEDPHKATVD
GVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAKASLTPVKSGENKDEEKP
KPKDRITSCLLENWNKGEGLGYEGIGLGIRGAIRLPSFKVKRKEPPEAASAGDQKRIRPS
PSVDDEDEESERDRDLPDATSDLSKKDADGVGLRRRPARPLELDSEGEEEDSGKEEEEEE
SSSEKEAEQEEEEGVMKSVSDKEEEEEHANEEEEEEEEEDDDAEVETSEKEEEQDSEEED
IGSPASSRAEVESSDESDESSEFGTSSDSDEDEEEEEEEEEEEEEEVEEDYDEGGSMEQE
REAVPTEITVEPLAQEPEDEDEKETILELFPVEDDVYMQGVPLAQVEPSVPEGEELKEEA
QQVEEESGEVPEESLAAEVLMVMERTEEEKLQQSPACLPVEEPEPDTELEREVLDSPKPE
SQEEENFRPPTPVGLFGEVSSSKNSFFTKSEDSRLEAQAKSNLQPAVEEEQQQQHPRTPG
RDVLAHMDSSVLPVHPVPPCSLPLPSVGSMKEEPLLLPDKFPEQITVTKPSVEEELPRTP
GRDILARCSHSLSKSQSTDTVPATPGSDAPLTGSSLTLSSPQVPGSPFSYPSQSPGIASG
IPRTPGRDFTFTPTFPEPGATHPCLLSVKKLSEDEPDEKVFKEPLGASLLVGMNSVPSPI
PFASPPVPAFHTHIDLSPNKQLPLSVRPCLFMDSKMSLEECSTEGRSLLPFPEVPATSPP
LPPSLPPSSSVLPVRRKPGRPKRASPLGPVLDAYSGKPLEPPLLPIPVALTESAVSKELL
SGHPDAFYSLKDPEAVTLDFRNDSFHDKVAPEVFAEKLPFKELENQWNEDFKEEDAHLKS
KRQWRRQKKRPEDVPTVPSPEYSPHRYHFRPRSEFEEMTILYDIWNGGIDDEDIHFLCVT
YDHLLQQDNGMDWLNDTLWVYHPSTSFLTPKKKKRDDGMREHVTGCARSEGYYKIDKKDK
LKYLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFN
QLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGS
SYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQYINVNEEIT
YDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6021 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaagagatcaaggcaggagagaaagcgaagcacaccgaagaccatggcaaa
aaacagagttcaagctggatcaacggaatggagagcagctcccaagctagcacctctgcc
gagaaaaggaatcaccattgcaaaagttacaagttgattattgacccagctttgaaaaaa
ggacagcacaaactctatcgttacgatgggcaacattttaacattcctaactctggtctt
gccccagtggattgtgtcagagatcccaggataggacgaatatggaccaaaaccaaagag
ctggagctttctgtccctaaatttaagattgatgaattctacgtggggccggtgcctccc
aaacaagtcacgtttgccaagctgaatgacaatatccgtgagaacttcctcctggacatg
tgtaaaaaatacggtgaagtggaagaagtggagatcctctacaaccccaagaacaagaag
caccttggaattgccaaagtgatctttgccacagtcaaaggggcccgggaagcagtacag
cacctgcacaacacttctgtcatgggcaatatcatccacgtggaactggatacaaaaggt
gaaaaacgtatgcatttctatgagctacttgtaaatggactctacactcctcagaccctt
cctgtagaaaatgagccagatgcttcacccactgtgaatgaaactctgcagttggctgat
accctgaaacgcctaaaagacagcagcctttcctccgtgggatcatcagttaccccaaac
agtagcaccccattttcccatgatacagccttctccagttgtcggcaagacaccccaaac
tctttcagccaatttacccctcagtcccagggaacccctctcaccccacgcgtggggact
cctttttcccaagactcggcatactctagtcgtcagacgacaccatcttaccatttcaga
caggactctgggtataagcccaggagacatgaaacaaaatttaccgatgcctacaataga
cgtcccggccaccactacgttcataattctgcaggtgcttttcgaggttcagagcatcaa
tttagcacgttcaagtcccatcagcaagaaacggtgcaatattcccacactcctcctttg
agtcactcggggtcttcaacgtacaaatcggccttctccccgtaccaagcaccaaccacg
tttcctcagcctgaagaaccgccccttccccaagcatccagagaagtcgagtaccagcga
cctccactgcctcccgaagagtcgcccgttaaaagcagcactgctaccacccctgagttt
gttcctgtgaaggaaaagcctgaggagcccccgcccctcccagagtcgaacagtcttagt
gagccagctgtggtacccttctcacagactccagaaaggagtgagaccccgggcacccca
accctggaatctgacgttcagcataacagtttggactcgaggattgagatgctcttgaaa
gagcagagaacaaagctctattttctcagtgagcatgactcggacaacgagattcgaatg
gaaggaagtccaatctcttcttcctcctcccagctttccccaatcgcaacatttggttcc
agctctcagccgggtcacaggccacagaccccatcctcgcgtccttccagcactggcttg
gaggacattagcccaacgccgttacccgattccgatgatgatgagccggttcttggaacg
gcttctctctgccagaattcaagagggacatcagacacaagtatgactcctgttgaccag
ctatgtaggacttctaaaactgagtcctctgagactaaagaaatgctgcctggtaaccag
agtccggtatcagaaaaaatggacgagtgtcatcagtcttcgggggaggacatggagatc
tcggacgacgaaatgaaccagtctcccatcacaagcgcagaatgtgccaaaaacattgtg
atgaatacctcagtcaacagctctgctgtgatggctccttccatccccatgcccccgccc
gggtaccctcccctgcctccgccacctccacaccagcctggcttcccgatgccgccgcct
ctccctcctccgccacctccgccaacgcacacgacagtcactgtcccgcctcctcccctt
cctgcgcctcccggggtccccccgcctcatatcttgcctcccctccctccgttcatgttc
cctgtcatgcaaatggacatgatcagtgtcctgagcaaccagtgggggggcatgtcgatg
tctttccaaatgcaaacccagatgttgagccgcatgatgcaagggcataacacgtaccag
taccaccctttcatggggaaccggatgcagtttgtgaaccttcctccctaccggcacttc
tccatgggagccgcgattggccgtgggcagccctggccacctttgcccaagtttgaccct
tctgtccccccgccgggctatgagcccaagaaggaagatccgcacaaggccactgtggat
ggcgtcctcttggtgattgtgaaggaactaaaagcaatcatgaaaagggacttgaaccgg
aagatggtggaggtggtggccttcagggctttcgatgactggtgggataagaaagaacgt
ctggcaaaggcatccctcactccggtaaaatctggagagaataaagatgaggaaaaaccg
aaacccaaggatcgcatcacatcctgtctcctggagaactggaataaaggagagggtctg
ggctatgaagggattggcctgggtatccgaggggccatccggctaccatctttcaaggtg
aagcgaaaggagccacctgaagctgcctcagctggagaccagaaaagaatccgcccctcc
ccttcagtggatgatgaagatgaagaatctgaacgagaccgagacctgccagacgcaacc
tccgacctctccaagaaggatgcagatggtgtcggcctccggcgaagacccgcccggcca
ctggaactagacagtgagggagaggaggaagattcgggcaaagaggaggaggaggaggaa
tcctcttcagaaaaggaggcagagcaggaggaagaggaaggagtgatgaaatcagtgtcg
gacaaggaagaggaagaagaacatgctaatgaagaggaggaagaagaggaggaagaagat
gatgacgctgaagtggaaacaagtgaaaaggaagaggagcaggattctgaagaggaggat
atcggaagccctgcctcctccagggcagaggttgagtcgtctgatgaaagtgatgaatcc
tcagaatttggaacgagttctgattctgatgaagatgaagaagaggaggaggaggaggag
gaggaggaggaggaggaagtggaggaagattatgatgaaggggggtctatggagcaagaa
agagaagccgtacccacagaaataacagtggagcctcttgcacaagagcctgaggatgag
gatgagaaggagaccattctggaattgtttccagtagaagacgacgtgtacatgcagggg
gttcccctagcacaggtggaaccttctgtgccggaaggagaggaactaaaggaagaagcc
caacaagtggaggaggaaagtggcgaggtgcccgaggaatctcttgctgcagaagtgctg
atggtgatggagcgtaccgaagaggagaagctgcaacagtcccctgcctgcctaccagtg
gaggagcctgaaccagatacggagctggaacgtgaggtgctagacagtccaaagccagaa
tctcaagaggaggaaaacttccgtccaccaacaccggtggggctctttggagaggtctcg
tccagcaaaaactcgtttttcaccaagtctgaggacagccgcttagaagcccaagcaaaa
agcaacctgcagcctgcagtggaggaagagcagcagcagcagcaccctcggactcctggg
cgggatgtcctggcccacatggactcttctgtacttcctgtccaccccgtgcccccctgt
tcacttcccctcccgtccgttgggtccatgaaagaggaaccgttgctccttccagacaag
ttccccgaacagataactgtgaccaaaccatcagtggaggaagagctccctcggactccc
gggcgggacattttagccaggtgctcccacagtctttccaagtcccagagcacggacacg
gtcccagccacacctggcagtgatgctcctctcacaggaagcagcttgactttaagttcc
cctcaagtcccaggaagccccttttcctacccgtcacaatcccccgggatcgccagcggc
atccctcggactccggggagggatttcactttcacgcctacgttcccagagcctggtgct
acccacccttgcctcttgtccgtcaagaagctctccgaggatgaacccgacgagaaagtc
tttaaagaacctcttggtgcttccttattggttggcatgaacagtgttccctcccccatt
ccctttgccagccctcccgtcccggctttccacacgcacattgacttgtctcccaacaag
cagttacctctttctgtccggccttgcctattcatggactcgaagatgtctttagaagag
tgtagcacagaaggaagatctcttttgcccttcccagaagtccccgctacgtccccacct
ctccctccatcgcttcccccatcctcgtccgtcctgcctgtcagaaggaaacctggtcgg
ccaaaaagggcgtctcctctgggccctgtgttggatgcctattccggcaagcccctcgag
ccacctctcctcccaatcccagttgccttgacggaaagtgctgtgagcaaagagttgtta
agcggccacccagatgcattctactccctaaaagacccagaggctgttaccttggatttc
aggaacgacagcttccatgacaaggtggcaccagaggtcttcgctgagaagctccccttt
aaggaactggagaaccaatggaatgaggacttcaaagaagaagacgctcacttgaaatcc
aaaaggcagtggcggcgccagaaaaagaggccggaagacgtcccgactgttccttctcct
gaatattccccgcatcgatatcactttaggccccgctccgagtttgaggagatgactatt
ttgtatgacatatggaacgggggtatagatgacgaggacatccatttcctgtgcgttaca
tacgatcacttgttgcagcaagacaacgggatggactggctcaacgacaccctttgggtg
taccatccctcaaccagctttttgaccccaaagaaaaagaaacgggacgatgggatgcga
gaacacgtgacaggctgtgcccgaagcgaaggctattataaaatcgacaagaaggacaag
ctgaaatacctcaacaacagccgtgcgtttgctgaggaacctccagctgacacacaggga
atgagcatccccgcccagccacatgcttccacccgggctggctcggagaggaggtcagag
caacgccggcttctgtcgtccttcaccgggagttgcgatagcgacttgctcaaattcaac
caactcaagttccggaagaaaaagctaaaattctgtaagagccacattcacgactgggga
ctgtttgcaatggagcccatcgctgctgacgagatggtgatcgagtacgtgggccagaac
atccggcaggtcattgccgacatgcgagagaaacgctacgaggatgaaggcattgggagt
agttatatgttccgagttgatcatgacactattatagatgcaaccaagtgtggaaacttt
gcccgatttattaatcacagttgcaatccaaattgttatgctaaagtcatcacggtggag
tctcaaaagaagatcgtcatctactcgaagcagtacatcaacgtgaacgaggaaattacc
tatgactacaaattccccattgaggatgtcaagatcccctgtctttgtggctcagagaac
tgcagagggaccctgaattaa

DBGET integrated database retrieval system