KEGG   Gekko japonicus: 107116011
Entry
107116011         CDS       T04299                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
gja  Gekko japonicus
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 DUF5663 C1_2 Mst1_SARAH
Other DBs
NCBI-GeneID: 107116011
NCBI-ProteinID: XP_015273342
LinkDB
Position
Un
AA seq 373 aa
MNRSTSQEMIELKNLNLEKQLDLTRGLRGTSERPVRLERANALRIAPGKVPEILSRVRQI
RLLGGQSDPKLTEELGEGHIFKPCTQNQPTWCDLCGEFIWGMYKKRLQCVHCKFICHYRC
RVLIRLDCSGPRYQDSDQNECNEQTVEKDTNVDEQIDWEKPILSQTEIEQKIKEYNGQIN
SNLFMSLNKDGSYTGFIKVQLKLIRPVSVPANKKAPSIQDTRKSSSRSQAVKRRTSFYLP
KDTVKHLHIISRTCASEVIEALLKKFMVVDNPRKFALFERTEKDDQVYLRKLSDEEQPLR
LRLLAGPNEKALSFVLKENETGEVNWDAFSMPELQNFLRILQREEEEHVRQILQKYTHCR
QKIQEALTTRTPG
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaccggtccacgagccaggagatgatcgagctgaagaacctcaacttggagaagcag
ctggatctgactcgaggcttgcgaggcacatccgagcgcccggtccggctggagagggcc
aacgccttgaggatcgcccccgggaaggtgcccgagatcttgagccgcgtgagacagatt
cggctcctgggcggccagagcgaccccaaactgaccgaggagctgggcgaggggcacatc
ttcaagccttgcacccagaatcagccgacctggtgcgacttgtgcggggagtttatctgg
ggcatgtacaagaagcgtctgcagtgtgtccactgcaagttcatctgtcactaccgatgt
cgtgttctgatccgacttgactgcagcggtcccagatatcaagacagtgatcagaatgaa
tgtaatgagcagacggtggaaaaagacaccaatgtggatgagcagattgactgggagaag
cctattttgtcccaaactgagattgagcagaagataaaggaatacaatggccagatcaac
agcaacctcttcatgagtttgaacaaagatggttcctacaccggcttcatcaaggtgcag
ttaaagctgattcgtcctgtctcagtgcctgctaataaaaaggcaccctctatccaagac
acaagaaagagctcctcacgcagccaagcagtaaagcgccgcacctcattctacctaccc
aaggacacagtcaagcacttgcatataatttctcgtacatgtgccagtgaggtcatagag
gccctgctcaagaaattcatggtcgttgacaacccccgcaagtttgccctctttgagaga
acagaaaaagatgaccaagtgtatctccgcaaactttctgatgaggaacaacctctgcgt
ctccgactgctggctggccctaatgaaaaagcacttagttttgttctaaaagagaatgag
actggagaagtcaattgggatgcttttagtatgcctgagctgcagaacttcctgcgtatc
cttcaacgtgaagaagaggagcatgtcaggcagatcctgcaaaaatatacccactgccgc
caaaagattcaggaggctctgaccacccggaccccgggttga

DBGET integrated database retrieval system