KEGG   Gekko japonicus: 107116125
Entry
107116125         CDS       T04299                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
gja  Gekko japonicus
Pathway
gja04060  Cytokine-cytokine receptor interaction
gja04068  FoxO signaling pathway
gja04218  Cellular senescence
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja04672  Intestinal immune network for IgA production
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107116125 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107116125 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107116125 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107116125 (IL6)
   04621 NOD-like receptor signaling pathway
    107116125 (IL6)
   04623 Cytosolic DNA-sensing pathway
    107116125 (IL6)
   04625 C-type lectin receptor signaling pathway
    107116125 (IL6)
   04672 Intestinal immune network for IgA production
    107116125 (IL6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107116125 (IL6)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107116125 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gja04052]
    107116125 (IL6)
Cytokines and growth factors [BR:gja04052]
 Cytokines
  Interleukins
   107116125 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL23
Other DBs
NCBI-GeneID: 107116125
NCBI-ProteinID: XP_015273481
LinkDB
Position
Un
AA seq 241 aa
MTKLFLDELSQDSMVIITSLLKGCLLAAAALPLLLGASASPILDSSGEEQFSEDPSSRTS
PARDLQLANCKYLAIMLRRKAFTWKEELCKEQTICKNNTEIILQNNLHFPKISVEDECPP
RKFNKERCLRGISDGLYVYQAFLEYIEETFVSKEQETAFIWPRTKHLANTLKSMMNTPDT
VSTPNPATKEALSTQLRAHTGWNRKVIHYLILQNYISFMEKTVRAIRAVRGWESECLTSG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaccaaattattcttggatgagctttctcaggatagcatggtcatcatcaccagtctg
ctaaaaggctgccttttggctgccgctgccctcccgttactccttggggccagcgcgtcg
cctattctggattcttctggggaagagcaatttagcgaggatccctcttccaggacttcg
ccagccagagacttgcagctggccaattgcaagtatctggccattatgctccggagaaag
gctttcacttggaaggaagagctgtgcaaggagcaaacaatatgtaaaaacaacacagaa
ataatactccagaataatctccactttccaaagatctctgtggaagatgaatgtcctcca
cgtaaattcaacaaggagaggtgcctaagaggaatttcagatggcctttacgtatatcag
gctttcttggaatatatagaagaaacctttgttagtaaagaacaagaaactgcatttata
tggccacgcacaaagcacctggctaataccttgaagtccatgatgaacactccagatact
gtgagcacgcctaatccagccactaaggaagccctttctacacagctacgagcgcatact
ggttggaataggaaggttatccactacctcatacttcaaaattatatttcatttatggag
aaaactgtaagggctattcgtgctgtgagaggctgggaatctgaatgccttacgtcaggt
gcataa

DBGET integrated database retrieval system