KEGG   Gekko japonicus: 107116244Help
Entry
107116244         CDS       T04299                                 

Gene name
ACLY
Definition
(RefSeq) ATP citrate lyase
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
gja  Gekko japonicus
Pathway
gja00020  Citrate cycle (TCA cycle)
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107116244 (ACLY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107116244 (ACLY)
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     107116244 (ACLY)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107116244 (ACLY)
  Exosomal proteins of bladder cancer cells
   107116244 (ACLY)
  Exosomal proteins of melanoma cells
   107116244 (ACLY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Citrate_bind Citrate_synt Ligase_CoA CoA_binding ATP-grasp_2 Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 107116244
NCBI-ProteinID: XP_015273618
LinkDB All DBs
Position
Un
AA seq 1123 aa AA seqDB search
MSAKAISEQTGKEFLYKYICTSSAIQNRFKYARVTPETDWDHLIQDHPWLLTERLVVKPD
QLIKRRGKLGLVGVNLDLNQVKAWLKPRLGHETTIAKAKGILKNFLIEPFVPHKQTEEFY
VCIYAAREGDYVLFHHQGGVDVGDVDAKAQKLLVGVDEKLDESAIKKHLLVHAPPDKKDV
LASFISGLFNLYEDLFFTYLEINPLVVTAEGVYVLDLAAKIDATADYICKVKWGDVEFPP
PFGREAYPEEAYIADLDAKSGASLKLTILNPKGRIWTMVAGGGASVVYSDTICDLGGVDE
LANYGEYSGAPSEQQTYDYAKTILSLMTQEKHPEGKILIIGGSIANFTNVAATFKGIVRA
IKDYQGPLKEHEVRIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPAAAHTANFLLNASGSSSEMTPDCSDVVTRPEACSQEGRATPAPSRTASFSE
CRPDDLAPAKKAKQAVPSDASLSSRPVQGKATTLFSRHTKAIVWGMQTRAVQGMLDFDYT
CSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSA
YDSTMETMNYPQIRTVAIIAEGIPEALTRRLIKTANEKGVTIIGPATVGGIKPGCFKIGN
TGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVFEGVAIGGDRYPGSTFM
DHVLRYQDTPGVKMIVVLGEIGGTEEYKICRGVKEGRITKPVVCWCIGTCATMFSSEVQF
GHAGACANQASETAVAKNKALKEVGVYVPRSFDELGDVIQSVYEDLVSKGVIEPAQEVPP
PTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWF
QRRLPKYACQFIEMCLMVTADHGPAVSGAHNTIVCARAGKDLVSSLTSGLLTIGDRFGGA
LDAAAKMFSKAFDSGIIPMEFVNKMKKEGRLIMGIGHRVKSINNPDMRVQILKDYVKQHF
PATPLLDYALEVEKITTSKKPNLILNVDGFIGVAFVDALRHCGSFTREEADEYIDIGALN
GIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMTM
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaaagctatatctgagcagaccgggaaggagttcttgtataaatacatctgc
acctcgtccgccatccagaaccgcttcaaatatgccagagtaacacccgagaccgactgg
gaccatctaatccaagatcatccctggctgttgactgagcgtctggtggtgaaacccgat
cagctgatcaaacgacgcggcaagctgggcctagttggggtgaatctcgacttgaatcaa
gtgaaggcctggctgaagccacggctgggtcacgaaaccacaattgccaaagcaaaaggc
atcctgaagaacttcttgatagaaccttttgttccacacaaacagacggaggagttctac
gtgtgcatttacgctgcccgcgagggggactacgtgcttttccaccaccagggtggggtg
gacgtgggcgatgtggatgccaaggctcagaagctgctggtgggcgtcgatgagaagctc
gacgagtcggcgatcaagaagcacctcttggtgcatgccccaccggacaagaaagatgtc
ttggcaagcttcatctctggcctgttcaacctctatgaagacctattttttacgtatctg
gaaatcaacccactagtcgtaactgcagagggtgtttacgtgctggacctggcagcaaag
attgacgcaacagctgactatatctgcaaagtgaaatggggcgacgtggagttcccccct
ccttttggaagagaggcatatccagaggaagcctacattgctgacctcgatgccaagagc
ggagccagtttaaagttgaccatcttgaatccaaagggcagaatttggaccatggtggct
ggaggcggagcttctgtcgtgtacagtgacaccatctgtgaccttggcggggtagacgaa
ttggcaaactacggcgaatactccggcgctcccagtgagcagcagacctacgactatgcc
aaaacaatcctctccctcatgacacaggaaaaacatcccgaaggcaaaatcctgatcatc
ggagggagcattgctaatttcaccaacgtagccgccacatttaaggggattgttagagcc
attaaggattaccagggccctctgaaagagcatgaggtgcggatcttcgtaaggagaggg
ggcccaaactaccaggaaggcctgcgtgtcatgggggaagtagggaaaacaaccggcatc
ccaatccacgtctttggcaccgagacccacatgactgccattgtcggcatggccctggga
caccggcccatcccaaatcagccccccgctgcggctcacacggcgaactttctccttaac
gccagcggcagctcctcggaaatgacccctgattgttcggatgttgttacccgccctgaa
gcctgctcgcaggaaggaagggctactccggcgcccagcaggacagcgtctttttctgag
tgccggcccgacgatctggctcctgccaagaaagccaagcaagcagtcccttctgatgca
tcactatcttcgagacctgttcaaggtaaagccacgaccttgttcagccgtcacaccaaa
gcgattgtgtgggggatgcagacccgggccgtgcaagggatgctggactttgactacacc
tgctccagagacgagccttcggtggccgccatggtctatccgttcactggtgaccacaaa
cagaagttctactggggccacaaagagatcctgatcccggtcttcaagaacatggcagac
gccatgagaaagcacccggaagtggacgtgctgatcaacttcgcatcccttcgctccgcc
tacgacagcaccatggagaccatgaactacccacagatccgtaccgtggctatcattgct
gaaggtatcccagaggcgctgacccgcagactgatcaagacagcaaatgagaagggagtt
acgattattggacccgcaacggtaggtgggatcaagccaggctgttttaagattggaaac
accggtggaatgctggataatatcttggcatctaagctgtaccgccctggcagcgtagcc
tacgtttctcgttcaggagggatgtccaacgagctcaacaacatcatctccaggaccaca
gatggggtctttgaaggagtagccattggtggcgacagataccctggttctacttttatg
gatcatgttttacgctaccaggacactccaggggtgaagatgatagtggtgctaggagaa
atcggaggaaccgaggagtacaagatttgcaggggggttaaagaaggccggatcactaag
cctgtcgtctgctggtgcattgggacgtgtgcaaccatgttctcctcagaggttcagttt
ggccatgcaggagcttgtgccaatcaggcatccgaaacggcagtggccaagaacaaagct
ctgaaagaagtgggtgtttacgtacctcggagtttcgacgagctgggcgatgtgattcag
tctgtgtatgaagatcttgtttccaagggcgtgattgagcccgctcaggaggtgcctccc
cctactgtgccaatggactactcgtgggcgagggaacttggtttgatccggaaaccggct
tccttcatgacaagcatttgtgatgagcggggccaggagctgatctacgctggcatgccc
atcacggaggtcttcaaagaagagatgggaatcggtggcgtcttaggtctgttgtggttc
cagaggaggttacccaagtatgcctgccagttcatagaaatgtgtttgatggtgacggcc
gaccatgggcctgcggtatcaggagcccataacacaatcgtctgtgcgagagcggggaag
gacctggtctccagcctcacctctggcctgctgaccatcggggatcggttcggtggcgct
cttgacgcagccgcgaagatgttcagcaaggcgtttgacagcggcatcatcccgatggag
tttgtgaacaagatgaagaaagaagggaggctgatcatgggcatcggccaccgggtgaaa
tcgatcaacaacccagatatgagagtccaaatcctcaaggattatgtgaaacagcatttt
cctgcaacaccccttttggactatgcgctggaagtggagaagattactacatccaagaaa
cctaatctcatcctgaatgtcgacgggttcatcggagtggcctttgttgatgcactcagg
cactgtggctccttcacacgggaggaagcggacgagtacattgacatcggtgccctcaac
ggcatctttgtacttggcaggagtatggggttcattggacattacctagatcagaagagg
ctgaagcagggcttataccgtcacccctgggatgacatctcctacgtcctgccggagcac
atgaccatgtga

DBGET integrated database retrieval system