KEGG   Gekko japonicus: 107116457Help
Entry
107116457         CDS       T04299                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
gja  Gekko japonicus
Pathway
gja00350  Tyrosine metabolism
gja01100  Metabolic pathways
Module
gja_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107116457 (GSTZ1)
Enzymes [BR:gja01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     107116457 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 107116457
NCBI-ProteinID: XP_015273836
LinkDB All DBs
Position
Un
AA seq 217 aa AA seqDB search
MCAALVKPVLYSYFRSSCSWRVRIALALKGIAYDQAPVNLVKDGGQQLSPEFFSVNPMRQ
VPALKIDGVTLSQSLAIIEYLEETRPNPRILPQDPKKRAQVRIISDVIASGIQPLQNLSI
LQQVGDKKLEWAQLCISGGFKALEQILQETSGRYCVGDEVSMADLCLVPQVYNAERYKVD
LAPYPTLRRINKALLELEEFQTSHPSRQPDTPPELRA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgccgcgttagtaaagcctgttctttatagttatttcagaagttcctgctcctgg
agagtacgaattgcattggctttgaaaggaattgcctatgatcaagcaccagtgaatctt
gtgaaggatggagggcagcagctgtcacctgaattcttttctgtgaatccaatgcgacaa
gtcccggcactcaaaatcgatggggtcaccctctctcagtcactggccataatagagtat
ctggaggagacacggccaaaccctaggatcctacctcaggatcctaagaagagagctcaa
gtccggataatctctgatgtcattgcttctggaattcaaccattacagaacctctccatc
ctgcagcaagttggggataagaagctggaatgggcccagctctgtatctctggtggcttt
aaagctttggagcagatcctgcaggaaacatctgggcgctactgtgttggggatgaggtg
tccatggctgacctgtgcttggtccctcaggtgtacaatgcagagaggtataaagtggat
cttgctccgtaccccacactcagaagaatcaacaaagctcttctggagttagaggaattc
cagacaagccacccatcccggcagccagatacccctccagaactaagagcctaa

DBGET integrated database retrieval system