KEGG   Gekko japonicus: 107116591Help
Entry
107116591         CDS       T04299                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
gja  Gekko japonicus
Pathway
gja00500  Starch and sucrose metabolism
gja01100  Metabolic pathways
gja04910  Insulin signaling pathway
Module
gja_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107116591 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107116591 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107116591 (GYS1)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     107116591 (GYS1)
Glycosyltransferases [BR:gja01003]
 Polysaccharide
  Storage polysaccharide
   107116591 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_5 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 107116591
NCBI-ProteinID: XP_015274015
LinkDB All DBs
Position
Un
AA seq 732 aa AA seqDB search
MPLARSLSVTSLTGLEDWDDELDLENSILFEVAWEVANKVGGIYTVIQTKAKITLDEWGE
NYFLIGPYLEQNVRTQVELIEPPSPAIRRTIDSMNAKGCKVYFGRWLIEGGPYVILIDIG
ATAWSLDRWKTELWESCSIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPYIIGHFH
EWLAGIGLVLCRIRKLPVATIFTTHATLLGRYLCAGSVDFYNNLQKFNLDKEAGDRQIYH
RYCMERSAVHCAHAFTTVSQITAVEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTIFFFIAGRYEYSNKGADIFLEALARLNYLLRVNGSQT
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANAVKEKFGKKLYESLLVGNLPDMNKML
DKEDFTMMKRAIFATQRQSFPPICTHNMLDDSTDPILNTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPTAYGIYIVDRRFRGLDESCTQLTSFLYSFCQQTRRQRIIQRNRTERLSDLLDWKY
LGRYYMYARHMALAKAFPDNFTYEPHEPTAAQGFRYPRPASVPPSPSISRHSSPHHSETE
DDDERYDEDEEAEKDKQNIKSTALMGAVPEWRKRSKKGSSEASTSSNASTPTLPSSPSDL
SSPTNSLIEEKN
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggcccgcagcctttccgtgacctccctgacagggttagaggactgggatgat
gagctggacctggagaactccatcctctttgaggtggcctgggaagtggccaataaagtt
ggtgggatctacacagttatccagaccaaagccaaaatcaccttggacgagtggggcgag
aattacttcctgatcgggccttacctggaacagaatgtccgcactcaagtggagctaata
gagccacccagccctgccatccgccgtactattgattccatgaatgctaaaggatgcaaa
gtttactttggtcgttggctgattgagggtggcccgtatgtaattctcatagatattggg
gcaacggcctggagcctcgatcgctggaagacagagctatgggaaagctgctccattggg
attccctggtacgaccgagaagccaatgatgcggtactctttggcttccttacagcatgg
tttctaggagagttttctgcacaatgtgaagagaaaccctacatcattggtcacttccat
gagtggctggctgggattggtctcgtcctttgccggatccggaaacttccagtggctacc
atctttaccactcatgctaccttgctaggccgctacctgtgtgcgggtagtgtggacttc
tacaacaacctacagaaatttaatttagacaaggaggctggggaccgacagatttaccac
cgttactgtatggagcgatctgccgtccactgcgcgcacgctttcacaaccgtctctcag
atcacagccgtggaggctgaacatttgctaaaacggaagcctgatatcgtgactcccaat
ggtttgaatgtcaagaagttctcagccatgcatgaattccagaacctccatgcacagagc
aaggctcgcatccaggagtttgtccggggacacttctatgggcacctggacttcaacctt
gacaagaccatcttcttcttcattgctggacgctacgaatattccaataaaggggccgac
attttcttggaagctctggcccggctgaactacttgctcagggtgaacggcagccagacc
acagtggtagcctttttcatcatgccagcccggaccaataacttcaatgtggagactctg
aaaggccaggcggtccgcaaacagctctgggatacagccaatgcagtgaaggagaagttt
ggcaagaaactctatgaatcactccttgtggggaatcttccggacatgaacaaaatgctg
gacaaggaagatttcaccatgatgaagagagccatttttgccactcagcgccagtccttc
cccccgatctgcactcacaacatgctggatgactccaccgaccccatcctcaacaccatc
cggcgcattggcctcttcaacagcagtgccgaccgtgtgaaggtcatcttccatcccgaa
ttcttgtcttccaccagcccccttcttcctgttgactacgaggagtttgttaggggctgc
cacttgggggtgtttccatcttattatgagccgtggggctacacgccagccgaatgcacc
gttatgggcattcccagcatctccaccaacctctctggctttggctgcttcatggaggaa
cacatagcagacccaacagcttacggtatctacattgtggaccggcgtttccggggcttg
gacgagtcatgcacgcagctgacctcgttcctctacagcttctgccagcaaacccggcgg
cagcgcatcatccagcgcaaccgcaccgagcggctctctgaccttctggactggaagtac
ctgggcaggtattacatgtatgctcggcatatggcgctagcaaaggcattccctgacaac
ttcacctatgagccacatgaaccaacagctgctcagggcttccgctacccgcgcccagcc
tcggtgccgccgtcgccttccatctcccgccactccagcccccaccacagcgagaccgaa
gacgacgacgaacggtacgacgaggacgaggaagcggagaaggacaagcagaacatcaag
tccacggcgctgatgggtgccgtccccgagtggcggaagcgctccaagaagggctccagc
gaagccagcacctcctccaacgccagcaccccgaccctccccagcagccccagcgacctc
agcagccccaccaactctctcatcgaggagaagaattag

DBGET integrated database retrieval system