KEGG   Gekko japonicus: 107116877Help
Entry
107116877         CDS       T04299                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gja  Gekko japonicus
Pathway
gja00480  Glutathione metabolism
gja00980  Metabolism of xenobiotics by cytochrome P450
gja00982  Drug metabolism - cytochrome P450
gja00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107116877 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107116877 (MGST3)
   00982 Drug metabolism - cytochrome P450
    107116877 (MGST3)
   00983 Drug metabolism - other enzymes
    107116877 (MGST3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gja02000]
    107116877 (MGST3)
Enzymes [BR:gja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107116877 (MGST3)
Transporters [BR:gja02000]
 Other Transporters
  Pores ion channels [TC:1]
   107116877 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG DmsC
Motif
Other DBs
NCBI-GeneID: 107116877
NCBI-ProteinID: XP_015274385
LinkDB All DBs
Position
Un
AA seq 143 aa AA seqDB search
MVVLSKEYGYVVLTGAASFILVTHLAINVGRARKKYNVEYPVMYSTDPENGHIFNCIQRA
HQNTLEVYPSVLFFLATGGAYYPRVAAGLGAAWIIGRLLFAHGYYTGDPKKRNRGAIGSF
ALLGLAGTSLYAALQHLGWTNRV
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgctgtccaaggaatacggctatgtggtcctgactggtgctgccagttttatt
ttggtaacgcaccttgcaatcaatgttgggcgagcacgcaagaagtataatgtggagtac
ccagtcatgtacagcacggaccctgaaaatggacatatcttcaactgtatccagagagcg
catcagaacacgctggaagtatacccctctgtcctgttctttcttgccacaggtggcgcc
tactacccacgtgtcgctgcggggctgggtgccgcgtggatcattgggagactgctcttt
gcccacggctactacacaggagatcccaaaaagcggaaccgaggggccattggctcattt
gccctcctgggcttggcagggacttccctgtatgcggctctgcaacaccttggctggacc
aaccgtgtctag

DBGET integrated database retrieval system