KEGG   Gekko japonicus: 107116985
Entry
107116985         CDS       T04299                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04120  Ubiquitin mediated proteolysis
gja04140  Autophagy - animal
gja04144  Endocytosis
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107116985 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107116985 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107116985 (TRAF6)
   04140 Autophagy - animal
    107116985 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107116985 (TRAF6)
   04621 NOD-like receptor signaling pathway
    107116985 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    107116985 (TRAF6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107116985 (TRAF6)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107116985 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107116985 (TRAF6)
   04121 Ubiquitin system [BR:gja04121]
    107116985 (TRAF6)
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107116985 (TRAF6)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    107116985 (TRAF6)
Ubiquitin system [BR:gja04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    107116985 (TRAF6)
SSDB
Motif
Pfam: Med21 SlyX Tropomyosin_1 DUF4455 Spc29 UPF0242 DUF16 DUF1664 HMMR_N Baculo_PEP_C TMF_DNA_bd PspA_IM30
Other DBs
NCBI-GeneID: 107116985
NCBI-ProteinID: XP_015274505
LinkDB
Position
Un
AA seq 293 aa
MQRNELARHMQEFTQVHMRMMAQSLRSIIATTPSPMSFLGGLPFDPSLFSQAVPTQCECS
PEVQNFKETVQQLEGRLVRQDHQIRELIAKMETQNTHMGNLKRTIRNLEEKITEIEAQQC
NGIFIWKIENFSIYLKAQEEERPVVIHSPGFYTGKPGYKLCLRLHIQLPNAQRCANYISL
FVHTMQGEHDSHLPWPFQGTIRLSILDQSEGSPRHNHEEVMDTKPELLAFQRPTVPRNPK
GFGYVTFMHLQALKQRTYVKDDILLVRCEVVTRLDLTSLRREGFQPRSTDGTV
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcaaaggaatgagttggcacgccatatgcaagaattcactcaggttcatatgagaatg
atggctcagagtctccggagcatcattgctactaccccatctcccatgtctttccttgga
ggattaccttttgacccatcacttttctctcaagccgtgccaacccaatgtgaatgtagc
cccgaagtccagaacttcaaggagaccgttcagcaattggaaggtcgcttggtaagacaa
gatcaccaaattcgggaactgattgctaagatggagacacagaacacacacatggggaat
ctcaagcgcaccattcgaaatttggaagaaaaaattaccgaaatcgaagcacaacagtgt
aatggtattttcatctggaagattgagaacttcagtatatatctaaaagcacaagaagaa
gagaggcccgttgttatccacagtccaggcttctacacagggaaacctggctataagctt
tgtttgcggctgcatatccagttgccgaatgctcagcgctgcgctaactatatttccctt
tttgttcacactatgcaaggagaacatgacagccatctgccttggccattccaaggcacc
atacgactttccattctggatcagtcagaaggttctccaagacacaaccatgaagaagtg
atggataccaagcctgagctcttagccttccagcggccaacagtccctcgcaacccaaag
ggctttgggtatgtgactttcatgcatttgcaggcactaaaacaaagaacctatgtgaaa
gacgatattctgttggtacgctgtgaggtcgtgacgcgcttagacttaaccagtctccga
agagagggttttcagcctcgtagtactgatgggactgtgtag

DBGET integrated database retrieval system