KEGG   Gekko japonicus: 107117159
Entry
107117159         CDS       T04299                                 

Gene name
TAB1
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107117159 (TAB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107117159 (TAB1)
   04621 NOD-like receptor signaling pathway
    107117159 (TAB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107117159 (TAB1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107117159 (TAB1)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 107117159
NCBI-ProteinID: XP_015274706
LinkDB
Position
Un
AA seq 502 aa
MAAARRSLLQSEQQPSWTDDLPVCQLSGVGSSPNRLYTPDGKGTEAHPLEDNWLKFRSEN
NCYLYGVFNGYDGNRITNFVGERLSAELLLGQLNADHDDADVRKVLLQAFDVVERSFLET
IDDALAEKASLQSQLPEGVPHHQLPSQYQKIMERLKAVEKEISGGAMAIVAVILNNKLYI
ANVGTNRALLCKSTVDGLQVTQLNMDHTTENEDELFRFSQLGLDAAKIKQVGTVCGQEST
RRIGDYKVKYGYSDIELLSAAKSKPIIAEPEIHGGYPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIATEFAKQTSLDSVAQAVVDRVKRIHCDTYASGGERSKFCSRHEDMTL
LVRNFAYPLGEMSQPTLTPTQGGRVYPVSVPYSSSQSTSKTSVTLSLVMPSQGQMVNGAH
SSSTLDEATPTLTNQSPTVTLQSTNTHTQSSSSSSDGGLFRSRPSHSLQPDEDGRVEPYV
DFAEFYRLWNMDHSETGALTVS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcggcggcgaggaggagtctcctgcagagtgagcagcaaccaagttggacagatgac
ttgcccgtctgccagctgtcaggcgtgggttcatcccccaaccgtttatatactccagat
ggaaaaggaacagaagcccaccccttggaggataattggttgaaatttaggagtgagaac
aactgctacctctatggagtcttcaatggctacgatggtaaccggatcacgaattttgtg
ggggagaggctctctgcagagctcctgctgggccagctgaatgcagatcacgatgatgct
gacgtgcgcaaagtcctgctgcaggcttttgatgtggtggagaggagttttttggagacc
attgatgatgccttggcagaaaaggccagcctccagtcccagcttccagagggggtgcct
caccaccagctgccatctcagtaccagaaaatcatggagcggttgaaggctgtagaaaag
gaaatctctggcggagccatggcgattgtggcagtcattcttaacaacaagctttacatc
gccaatgtaggaacgaaccgtgcgctcttgtgcaaatctactgtagatgggttgcaagtg
acacaactcaacatggaccacaccacggagaatgaggatgagctattccggttttcccag
ctgggtttggatgcagcaaagataaagcaagtaggaaccgtatgtgggcaggagagcact
cgccgcattggggattataaggtcaaatatggctacagtgacattgaacttctcagtgct
gcaaaatccaaacctatcatagcagagcctgaaatccacggagggtacccgttagatgga
gtgacaggttttcttgttctgatgtccgaaggactctacaaagctctggaagcagctcat
gggcctgggcaagccaatcaggaaattgcagccatgattgccactgagtttgccaagcaa
acttcactggattctgtagcacaggcagttgtggatcgagtgaagcgcattcactgtgat
acgtacgccagtggcggtgaacggtccaagttctgctctcggcatgaggacatgacactg
ctagtgaggaattttgcatatccgctgggtgagatgagccagcccacactgaccccaaca
caaggaggccgggtttacccagtgtcagtgccatactccagcagccagagcactagcaag
accagcgtgacgttgtcccttgtgatgccttcccaaggccagatggtcaacggtgcccac
agtagctccacattggatgaagccacgccaactcttactaatcaaagccccaccgtgacc
ctccagtctaccaacactcatacccagagtagcagctcaagctcggatgggggcctcttc
cgttcccgcccctctcactctctccagccggatgaagatgggcgtgttgagccctatgtg
gactttgcggagttctatcgcctctggaacatggaccacagcgaaacgggggcactgact
gtgtcataa

DBGET integrated database retrieval system