KEGG   Gekko japonicus: 107117358
Entry
107117358         CDS       T04299                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
gja  Gekko japonicus
Pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04110  Cell cycle
gja04115  p53 signaling pathway
gja04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107117358 (CDKN1A)
   04068 FoxO signaling pathway
    107117358 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107117358 (CDKN1A)
   04115 p53 signaling pathway
    107117358 (CDKN1A)
   04218 Cellular senescence
    107117358 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107117358
NCBI-ProteinID: XP_015274944
LinkDB
Position
Un
AA seq 157 aa
MTRTPKRELKEMPLSQGDIPRSSCSRKLCRNLFGPVDHEQLQNDFQSMMKAELKEAQRKW
NFDFETETPLEGDYKWEKVSHFKVLSPQELLSHSKENSCVGDKTLSSPVLLQIHAKTDNP
GQGSFEAESSRHLKRKQTSIKDFYSSKRRTIPYKSNP
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaccaggacgccaaaacgggagctgaaggaaatgcctctgtctcagggtgatatccca
cggtcatcctgcagcaggaagctttgcaggaacctgtttgggccagtggatcatgaacag
ctccagaatgacttccagtccatgatgaaggcggaattgaaggaggcccagcgcaagtgg
aactttgactttgaaacagaaaccccacttgaaggggactacaaatgggagaaggtctcc
cattttaaagtgttgtcacctcaagagctgttgagccactcaaaggagaacagttgcgtt
ggagacaagaccctcagctcccctgtgcttctccaaatacatgcgaagacagacaatcct
gggcaggggagttttgaggctgagtcctcaaggcatttgaaacgaaagcagacgagcata
aaagacttctacagctcaaagagaagaactatcccatacaaatcaaatccatga

DBGET integrated database retrieval system