KEGG   Gekko japonicus: 107117392Help
Entry
107117392         CDS       T04299                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00052  Galactose metabolism
gja00500  Starch and sucrose metabolism
gja00520  Amino sugar and nucleotide sugar metabolism
gja00524  Neomycin, kanamycin and gentamicin biosynthesis
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja04910  Insulin signaling pathway
Module
gja_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gja_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107117392 (GCK)
   00052 Galactose metabolism
    107117392 (GCK)
   00500 Starch and sucrose metabolism
    107117392 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    107117392 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107117392 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107117392 (GCK)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     107117392 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF4795
Motif
Other DBs
NCBI-GeneID: 107117392
NCBI-ProteinID: XP_015274988
LinkDB All DBs
Position
Un
AA seq 530 aa AA seqDB search
MAGKKPEKAKLLKTKLVLLDLKLAALLRINTATLWNQEDIGRNNKLTKEGQDKNASDSWI
FLCFSIYFALAHQSSQSKRKVEQILSEFTLQEEDLKKVMYRMQKEMDRGLKLETHEEASV
KMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWNVKTKHQMYSIPEDAM
TGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDLDKGILLNWTKGFKASG
AEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMVSCYYEDHRCEVGMIVGTGCNACYM
EELQNVELVEGDEGRMCVNTEWGAFGASGELDEFLLEYDRVVDETSLNPGQQLYEKIIGG
KYMGEIVRLVLLKLVNENLLFNGEAPEKLKIRGSFETRFISQIESDPGDHKQIYNILNSF
GVMSSVTECDIVRMACESVSTRAAQMCSAGLAGVINRMRKSRCEETLKITVGVDGSVYKL
HPSFKDRFHAAVRQLTPGCDITFLQSEEGSGRGAALISAVACKMACMMGQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaagaaaccggagaaagcaaaactgttgaaaacgaaactagtgctactggac
ttgaagctagctgctctactgcggatcaacacagctaccctctggaaccaagaagatata
gggagaaacaacaagttgacaaaagagggacaggataaaaatgcatcagatagctggatc
tttctctgtttttctatttattttgctctcgcacaccaatccagtcagtccaaaagaaag
gtggagcagatcctgtcagagtttacgctacaggaagaggatctgaaaaaagtaatgtat
cggatgcaaaaggaaatggaccgagggctaaagctggagacccatgaagaggcttctgta
aagatgttgcccacatatgtgcgctccacccctgagggttcagaagttggagatttccta
tctttggatcttgggggcacaaatttccgagtgatgttggtcaaagtgggggaaggtgaa
gaagggcaatggaatgtgaagacaaagcaccaaatgtattccatcccggaggatgccatg
acaggaacagccgaaatgctctttgactacatctcagaatgcatctctgacttcctagat
aaacaccagatgaaacacaaaaagctacctctgggctttacgttttccttccctgtgaga
cacgaggacctcgacaaggggatcttgctgaactggactaaaggcttcaaagcatcagga
gctgaagggaacaatattgtggggcttttgagagatgccatcaaacggcggggggacttc
gagatggacgtggtagcaatggtgaatgacacagtggccaccatggtgtcctgctactat
gaagatcaccgatgtgaagtcggcatgatcgtaggcacgggttgtaatgcctgctacatg
gaagagttgcagaatgtagagctggtggaaggagatgaaggccggatgtgcgtgaacact
gaatggggagcttttggagcatcaggagagctggatgagttccttttggagtatgatcgt
gtggtggacgaaacctcgcttaaccccggtcagcagctgtatgagaagatcatcggcggg
aagtacatgggggagattgtgcggttagtgctgctaaaacttgtcaatgaaaatttgctc
ttcaacggagaagctccagagaagctcaaaatcagggggtcctttgaaactcgttttatc
tcacaaattgaaagcgaccctggcgatcacaagcagatctacaacatcctgaattccttt
ggggtgatgtcttcggtaacggagtgtgacattgttcgtatggcatgtgagagtgtttcc
acacgggctgcgcagatgtgttcagccgggctggctggtgtcattaatcgcatgaggaag
agcaggtgtgaggagacgttgaagattaccgttggagtggatggctctgtctacaagctc
caccccagcttcaaagatcggttccatgcagccgtcagacaactcacgccgggctgcgat
atcactttcctgcaatccgaggaaggcagcgggcggggagcggctctcatctctgctgta
gcgtgcaaaatggcctgcatgatgggccagtga

DBGET integrated database retrieval system