KEGG   Gekko japonicus: 107117554Help
Entry
107117554         CDS       T04299                                 

Gene name
POGLUT1
Definition
(RefSeq) protein O-glucosyltransferase 1
  KO
K13667  protein glucosyltransferase [EC:2.4.1.-]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107117554 (POGLUT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107117554 (POGLUT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     107117554 (POGLUT1)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Glc type
   107117554 (POGLUT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_90 Glyco_trans_1_2
Motif
Other DBs
NCBI-GeneID: 107117554
NCBI-ProteinID: XP_015275175
LinkDB All DBs
Position
Un
AA seq 285 aa AA seqDB search
CSGIEHFFLEILDRLPDMEFVVNVRDYPQVPKWTKPLIPVFSFSKTSEYYDIMYPAWTFW
EGGPAVWPIYPTGLGRWDIMREDLQSSAEHWPWKKKIPTAYFRGSRTSPERDPLILLSRE
NPDLVDAEYTKNQAWKSERDTLGKPPAKEVPLVDHCKYKYLFNFRGVAASFRFKHLFLCG
SLVFHVGEDWQEFFYAQLKPWVHYIPVKSDLSNVRELLQFVKENDDIVQEIAERGRQFIV
DHLQMEDISCYWERLLTEYSKALIYKVKWKSNYSEISPRPLKTEL
NT seq 859 nt NT seq  +upstreamnt  +downstreamnt
gtgtagtggcattgagcacttcttcttggagatccttgaccgtcttccagatatggagtt
tgtggtcaacgtacgggactatccccaggtgcccaaatggacaaaacctcttattcccgt
cttctccttcagtaagacttcagaatactatgatattatgtatcctgcctggacattttg
ggaaggaggaccagctgtctggcccatttacccaacaggcctaggacgctgggacataat
gagagaggacctccaaagctcagcagaacattggccatggaagaagaagattcccacagc
ctacttccgaggatcgcggacaagcccagagcgggaccccctcattcttctttctcgaga
aaatccagaccttgttgatgcagaatacactaaaaaccaagcctggaaatctgaaagaga
cacccttggaaaaccgcctgctaaggaagttcctctggtggaccattgtaagtacaaata
cctctttaatttccgaggtgtagcagccagttttcgattcaagcacctcttcctgtgtgg
ctcattggtttttcacgttggggaagactggcaggaattcttctatgcacagctgaaacc
ttgggttcactacatcccagtcaagtctgatctttccaatgtgagggagctgctacagtt
tgtaaaagaaaatgatgacatagtccaagaaattgcagagaggggtcgccagtttattgt
ggatcatttgcagatggaggatatctcttgctattgggaaagacttctaactgaatattc
taaagccctgatttacaaagttaaatggaagagtaactacagtgagatttcccccagacc
actgaaaacagagctgtag

KEGG   Gekko japonicus: 107119324Help
Entry
107119324         CDS       T04299                                 

Definition
(RefSeq) protein O-glucosyltransferase 1-like
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107119324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_90
Motif
Other DBs
NCBI-GeneID: 107119324
NCBI-ProteinID: XP_015277279
LinkDB All DBs
Position
Un
AA seq 125 aa AA seqDB search
MESLWLRRVATLFLFVFCCWGSRSADTNWKKFLVQISRAVENYRPCIKENCSCHQGVREQ
DLAPFREGISKELLSEAISRKLGTHYQIIEKKLYREHDCMFPARQESEQKRTGLASMCLM
ESSSR
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggagtctctctggctgcggcgagtggcaactctgtttctgtttgttttttgctgctgg
ggaagtcgctccgcagatacaaactggaagaaattcctggtccagattagcagagctgtg
gagaactacaggccatgcataaaagaaaactgcagctgtcatcaaggagttagggaacag
gacttggctccctttcgagaggggatctccaaggagttgctgtcagaagcaatcagtcga
aagctggggacgcactaccagatcattgagaagaagctgtaccgtgagcatgattgcatg
ttccctgcaagacaggagagtgagcaaaagcgcactggcctagcctccatgtgcttgatg
gaatcatcttcacgctga

DBGET integrated database retrieval system