KEGG   Gekko japonicus: 107117607Help
Entry
107117607         CDS       T04299                                 

Gene name
POFUT2
Definition
(RefSeq) protein O-fucosyltransferase 2
  KO
K03691  peptide-O-fucosyltransferase [EC:2.4.1.221]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107117607 (POFUT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107117607 (POFUT2)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.221  peptide-O-fucosyltransferase
     107117607 (POFUT2)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Fuc type
   107117607 (POFUT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: O-FucT DUF2491
Motif
Other DBs
NCBI-GeneID: 107117607
NCBI-ProteinID: XP_015275239
LinkDB All DBs
Position
Un
AA seq 353 aa AA seqDB search
MAPGARGPAAATTLLLLLLLGVVAAAAQPPLEAFQAGHSAPFSSLPAAASVAPHRRYLLY
DVNPPEGFNLRRDVYIRIASLIKTLSKSEAWVLVLPPWGRLYHWQSPDIHQVRIPWFEFF
DVPSLNKNIPVIEYEQFLAESGGPFIEQIYVLQNYAEGWKEGTWEEKINERPCIDQPTYS
MDKQKYYRGWFWGYEETRGLKLACLSVQGSASIIAPLLLNTSSRSVMLDRAENLLHDHYA
GKDYWDTRRSMVFAKHLRVVGDLFRAKYLNSTDEKDRTRYNEDWTKMKVKLGTALGGPYL
GVHLRRRDFVWGHRNDVPSLRGTVKKITSLMSLQKLERVFVATDAVADVYFNV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcacccggagcccgaggccccgccgccgccacaaccctccttctcctcctcctcctc
ggtgtcgtcgccgccgccgcccagccgcccctggaggccttccaggcgggccacagcgcc
cccttctcctcgctgcccgccgctgcttcggtggcgcctcacagacggtaccttttgtat
gatgtaaatccaccggaaggtttcaacctccgtagagatgtctacattcggattgcctct
cttataaagactttgtcaaaaagcgaagcttgggtattggtcttaccaccctggggacgt
ctctatcactggcagagccctgatatacatcaggtccgaattccgtggtttgaatttttt
gatgttccaagcctcaataaaaacatacctgtaattgaatatgaacagtttctcgcagaa
tcaggtggaccttttattgaacaaatatatgtcctgcaaaactatgctgaaggatggaaa
gaggggacttgggaggagaaaataaatgaaaggccatgcattgatcagcccacttattcc
atggacaaacagaaatactacaggggatggttctggggctatgaggagacacgaggcctt
aaattggcctgtttatcagtccagggttccgcttccatcatagctcctcttcttttgaat
acttcatctcggtcagtgatgctagacagagcagaaaaccttctccatgaccactatgct
ggcaaagactattgggatactcgtcgaagcatggtgtttgcgaagcacttgcgtgtggtg
ggagacctctttagagccaaatatctcaattccactgatgagaaggacaggacgcggtac
aatgaagactggacaaagatgaaggtgaaactgggcacggcccttggtggcccctacctg
ggggttcatctcaggcgcagagacttcgtctggggtcacagaaacgacgtgccgagcctc
cggggcacagttaagaaaatcaccagcctgatgagcctgcagaaactcgagagagtgttt
gtcgccacggacgccgtggcagacgtgtattttaacgtctag

KEGG   Gekko japonicus: 107123014Help
Entry
107123014         CDS       T04299                                 

Gene name
POFUT1
Definition
(RefSeq) protein O-fucosyltransferase 1
  KO
K03691  peptide-O-fucosyltransferase [EC:2.4.1.221]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107123014 (POFUT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107123014 (POFUT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.221  peptide-O-fucosyltransferase
     107123014 (POFUT1)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Fuc type
   107123014 (POFUT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: O-FucT
Motif
Other DBs
NCBI-GeneID: 107123014
NCBI-ProteinID: XP_015281655
LinkDB All DBs
Position
Un
AA seq 394 aa AA seqDB search
MAGLGSGLSGAAFSGLRLLLFLALLWPSSVDGGAWDPAGYLLYCPCMGRFGNQADHFLGT
LAFAKMINRTLAVPPWIEYRHHRPPYTNLHVPYKEYFKVAPLLEYHRVITLEEFMEKLAP
VHWPPGKRVAFCFEAAAQRSADKRTCPMKDGNPFGPFWDQFDVDFDSSELFGGLSFGASY
KDHWIRRFPPSEYPVLALPGAPAQFPVLEEYRPLHRFVVWSDNLVNKGESYINSFLVRPY
VGIHLRLGSDWKNACKMLTDGTAGSHLMASPQCVGYDRNTAAPLTTDMCLPDLKEIQRAL
KLWVEAVKAKAVYVASDSEPYTNEIQQLFSGKVKVVYLQPEVAQIDLYILGQSDHFIGNC
VSSFTAFVKRERDVHGRPSSFFGMDRPPELRDEL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccgggctcgggagcgggctgagcggcgcggccttctccggcctgcgcctcctcctc
ttcctcgccctgctgtggcccagcagcgtcgacggcggcgcctgggacccggcgggatat
ctcctgtattgcccctgcatggggagatttgggaaccaggcggaccattttctgggcacc
ttggcatttgccaagatgataaatcggaccttagccgtacccccctggattgagtaccgg
catcacaggcctccatacacaaacctgcacgttccctacaaggaatatttcaaggtcgcc
cctctcctggaataccaccgggttatcaccttggaggagttcatggagaagctggctccc
gtccactggcctcccggcaagagggtagcattctgctttgaagccgcggcccagaggagc
gccgataaaaggacatgccccatgaaggacggaaacccctttgggcccttttgggatcag
tttgacgtggatttcgatagttcggagctgtttggaggcctctccttcggtgcctcttat
aaggaccactggatccgaaggtttccgccctctgaatatcctgttctggccctcccgggg
gcaccagcccagtttccggttctggaggagtaccggcctctgcatcggtttgtggtgtgg
tctgacaacctggtgaacaagggagagtcctacattaattccttcctagtcagaccctac
gtgggaatacatctccgactgggctcagattggaaaaacgcatgcaagatgttgacggat
ggcacagctgggtctcatttaatggcttcgcctcagtgcgtgggctacgaccgcaacacc
gctgcccctctcaccacggacatgtgtctgccagacctaaaggaaatccagcgtgctctc
aagctctgggtggaggcggtcaaagcgaaagctgtgtacgttgccagtgattctgagccc
tacaccaatgagatacagcagctcttcagtggaaaggtcaaggtggtgtacctgcagccc
gaagtggctcagatagacctgtacatcctcggccagtccgaccatttcatcggcaactgt
gtctcttccttcaccgcctttgtgaaacgggagcgcgacgtccacgggagaccgtcctcc
tttttcggcatggaccgcccccccgagctgcgagacgagctgtag

DBGET integrated database retrieval system