KEGG   Gekko japonicus: 107117758
Entry
107117758         CDS       T04299                                 

Gene name
CHUK
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04068  FoxO signaling pathway
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107117758 (CHUK)
   04068 FoxO signaling pathway
    107117758 (CHUK)
   04150 mTOR signaling pathway
    107117758 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107117758 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107117758 (CHUK)
   04621 NOD-like receptor signaling pathway
    107117758 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    107117758 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    107117758 (CHUK)
   04625 C-type lectin receptor signaling pathway
    107117758 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107117758 (CHUK)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107117758 (CHUK)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107117758 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107117758 (CHUK)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     107117758 (CHUK)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107117758 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD APH YrbL-PhoP_reg DUF3783 PNMA
Other DBs
NCBI-GeneID: 107117758
NCBI-ProteinID: XP_015275407
LinkDB
Position
Un
AA seq 607 aa
MHTFNTKKPYFWETGTKIAIKSCRLELSMKNKDRWCHEIQIMKKLNHPNVVKACDVPEEM
NFLVNDVPLLAMQYCSGGDLRKLLNKPENCCGLKESQVLSILSDIGSGIQYLHENRIIHR
DLKPENIVLQEEGGKVTHKIIDLGYAKDLDQGTLCTSFVGTLQYLAPELFDNKGAGQIVH
ILNMTSAKILSFPLHPEESLHSLQCRIESETGIGTISQELLLEMGICLDPRKPASQCIID
GVRGWDSYMVYLFDKSKTIYDGPFASRSLSECVNCIVQDSKIQLPILRLRKIWAEAVHYV
MGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNNMVSASQQLKAKLKFFQQSIHLDLERY
SDQMTYGISSEKMLKAWKEMEEKALQCEQAGDIGYLDDQIMALHTEIVELQRSPHARRQG
DIMENLEQRAIELYKQLKPRAPDHSYSDSTEMVKIIVHTVQSQDWVLKELYRHLSKLLGC
KQKIIDLLPRIEVALSNIKEADNSVMQMQGKRQREIWHLLKIACTQSSAKSASSSVDASP
ASAWLSQTSPGNALQPLSSMAASRNEAPFSQLIEENLSYLSNFSSMIQDAAGNQNDSVMS
LDWSWLK
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgcacacctttaataccaagaaaccttacttctgggaaacagggaccaagattgccatc
aaatcttgccgcctggaactgagcatgaaaaacaaggaccgctggtgccacgagatccag
atcatgaagaagctgaaccaccccaacgttgtcaaagcctgtgacgtgcctgaagaaatg
aatttccttgtaaatgacgtcccccttttggctatgcagtactgctctggaggagacctg
aggaagctattaaacaagcctgaaaattgctgtggactcaaggagagccaggttctttct
attcttagtgacattggatctggaatccagtacttgcatgaaaacagaataatacacaga
gacctgaaacctgaaaatattgtcctccaggaggaagggggaaaggtaactcacaaaatc
atagacttgggatatgccaaagatctggatcaaggcaccctgtgcacgtcttttgttggg
actttacaatatttggccccagaactctttgacaataagggagcgggtcagattgtccac
atcttaaacatgacttccgccaagatcctttctttcccgttgcatcctgaggagagcctc
cactccctccagtgtcggattgagtctgagaccggcatcggcacgatcagccaggagctg
ctgctggagatggggatttgcctggacccccggaagccggcctctcagtgtatcatcgat
ggcgtgaggggctgggatagctacatggtctatctgttcgacaaaagcaagactatatac
gatggtccctttgcttctaggagcctgtctgaatgtgtaaactgcattgtgcaggacagc
aaaattcagttgcccattttacgacttcgtaagatatgggctgaagctgtgcattacgtg
atggggctgaaagaagactatagccgactgttccagggacagagagccgcaatgctgagt
ctcctgaggtacaacgccaacttgaccaaaatgaagaacaacatggtgtcggcatcccag
caactgaaggcaaagctgaagttcttccagcagagcatccaccttgacttggaaagatac
agcgatcagatgacctacgggatatcctccgaaaaaatgctgaaagcctggaaagaaatg
gaggagaaggccttgcagtgtgaacaggccggagatatcggctacctggacgaccagatc
atggccctgcacacggagattgtggaattgcagcggagcccccatgcacgacgccagggc
gatatcatggagaatcttgaacaaagagctatcgaactctacaagcaattaaagcccagg
gccccagatcactcctacagcgacagcacggagatggtgaagatcatcgtgcatacggtt
cagagccaggactgggtgctcaaggaactctacagacacctcagcaaactgttaggctgt
aagcagaagattattgacctgctgccgaggatcgaagtggctctgagtaatatcaaggag
gccgacaattccgtgatgcagatgcaagggaagaggcagagggagatctggcatttgctc
aaaatcgcttgcacccagagttctgctaaatccgctagttccagcgtagatgcatccccg
gcgtctgcatggctctcgcaaacctctccaggaaatgcacttcaacctctttcttctatg
gctgcctctagaaatgaggctcccttttcacagctgattgaagaaaatctaagctatctc
agcaattttagctccatgatacaagatgccgcgggcaaccagaatgacagcgtgatgagt
cttgattggagctggctaaagtag

DBGET integrated database retrieval system