KEGG   Gekko japonicus: 107118023
Entry
107118023         CDS       T04299                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04270  Vascular smooth muscle contraction
gja04370  VEGF signaling pathway
gja04371  Apelin signaling pathway
gja04510  Focal adhesion
gja04540  Gap junction
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04912  GnRH signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04916  Melanogenesis
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107118023 (RAF1)
   04012 ErbB signaling pathway
    107118023 (RAF1)
   04370 VEGF signaling pathway
    107118023 (RAF1)
   04371 Apelin signaling pathway
    107118023 (RAF1)
   04068 FoxO signaling pathway
    107118023 (RAF1)
   04150 mTOR signaling pathway
    107118023 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107118023 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    107118023 (RAF1)
   04218 Cellular senescence
    107118023 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107118023 (RAF1)
   04540 Gap junction
    107118023 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107118023 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107118023 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107118023 (RAF1)
   04912 GnRH signaling pathway
    107118023 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    107118023 (RAF1)
   04916 Melanogenesis
    107118023 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107118023 (RAF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107118023 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107118023 (RAF1)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107118023 (RAF1)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107118023 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like Pkinase_fungal zf-RING-like Kdo C1_2 APH DUF936 zf-C3HC4_2
Other DBs
NCBI-GeneID: 107118023
NCBI-ProteinID: XP_015275732
LinkDB
Position
Un
AA seq 673 aa
MEQIQGALRALSDGIGLKDSVFNGSNCISPTIVQQFGYQRRASDDGKLSDSSKTSNTIRV
FLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLLNEQKGKKLRLDWGTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTRV
PTMCVDWSNVRQLLDIAFDLRLFPHSNVGDSGVPMLPPVTTRRMRESVSRIPVNSQHRYS
TPHAFTFNTSNPSPEGSLSQRQRSTSTPNVHMVSTTMPVDNRIIENNSLNASPRSWCRRF
CLRGRDAIRSHSESASPSAISGSPNNTSPTGWSQPKMPVPVQRERATGSTTQEKKIRARG
QRDSSYYWEIEASEVMLSTRVGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEV
AVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMLQRIDIARQTAQ
GMDYLHAKNIIHRDMKSNNIFLHEDRTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAP
EVIRMQDSNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLY
KNCPKAMKRLVADCLKKVREERPLFPQILSSIELLQHSLPKINRSASEPSLHRATHTQDI
NSCTLTSTKLPVF
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggagcaaattcagggagctttgagggctcttagtgatggaattggcttaaaggattct
gtctttaatggatccaactgtatttcgcctaccattgtccagcagtttggttatcaacgc
agagcatctgatgatggaaaactttcagattcctccaaaacaagcaatactattcgtgtt
ttcttgcctaacaagcaacgcacagtggttaatgtacgtaatgggatgaccttacatgac
tgtctcatgaaggcactcaaagttagaggtctgcagccagagtgctgtgctgtttttaga
ctgcttaatgaacaaaaaggtaaaaaattacgattggattggggtacagatgctgcatcg
ttgattggagaagagctgcaagtggacttcctcgatcacgttcctctcacaacacacaac
ttcgcaaggaagacgtttctgaagctcgcgttctgtgacatctgccagaagttcttacta
aatggattccggtgtcagacatgtggctataaattccatgaacactgcagcactagagtt
ccaactatgtgtgtggactggagtaatgtccggcaactcctcgacattgcttttgatctc
agattgtttccacactcaaacgttggtgatagtggtgtccctatgctacctcctgtaaca
acacgccggatgcgggagtctgtgtcccggatacctgtaaactctcagcacagatattct
acacctcatgccttcacattcaacacatcaaatccttctcctgaaggttccctctctcaa
agacagagatctacatcaacccccaacgtccatatggtcagcactaccatgcctgtagac
aatcggataattgagaataacagcctgaatgcttctcccaggtcctggtgcagacgattc
tgtttaaggggaagagatgctattcgtagtcacagtgaatcagcatcaccctcagctata
tctggaagtcccaacaatacaagccccacaggatggtctcagcctaaaatgccagttcca
gtccaaagagagagagctacaggatctaccacacaagaaaaaaaaattagagctcgtgga
cagagagattcaagttattattgggaaatagaagccagtgaagttatgctctctaccaga
gtagggtcgggctccttcgggactgtttacaagggcaaatggcatggtgatgtagcagtg
aagatattaaaggttgtagatccaactccagaacagtttcaagcctttagaaatgaagtt
gctgtactaaggaaaactcggcacgttaatattttgctttttatgggctacatgacgaaa
gataatctggccattgtcacacagtggtgtgagggaagtagtctgtacaagcacttgcat
gttcaggagaccaagtttcagatgttacagcgtattgatattgcaagacagactgcacaa
ggaatggactacttgcatgcaaagaatataatacacagagacatgaaatcaaataatata
ttccttcatgaagatcgtacagtaaagataggagattttgggttagcaacagtcaaatcc
agatggagtggttctcagcaggtggaacaacctactggatctgttctctggatggcacca
gaagtgattcgaatgcaggatagtaatccatttagtttccagtctgatgtgtattcttat
ggaatagtactatatgaattgatgacgggagaattaccatattcccatattaacaacaga
gaccagatcatttttatggttggtcgaggttatgcatctccagacctcagtaaattatac
aaaaattgtcccaaagcaatgaaaagacttgtagcagattgtttgaagaaagtaagggaa
gaaagacctctttttccacagatactgtcttccattgaattgctgcagcattctttaccc
aaaataaaccgaagtgcttcagaaccttctctgcatcgtgcaacccacacacaggacata
aattcatgcacactgacatcgacaaagctacctgtgttttag

DBGET integrated database retrieval system