KEGG   Gekko japonicus: 107118151Help
Entry
107118151         CDS       T04299                                 

Gene name
PLOD3
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107118151 (PLOD3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107118151 (PLOD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anp1 2OG-FeII_Oxy 2OG-FeII_Oxy_3
Motif
Other DBs
NCBI-GeneID: 107118151
NCBI-ProteinID: XP_015275912
LinkDB All DBs
Position
Un
AA seq 722 aa AA seqDB search
MAEWKFRPESNSPVMWASKGKLLVLTAATEETEGYQRFLRTTKYFNYTVKTLGLGEDWKG
GDVARTVGGGQKVRWLKAEMKKYVNEEDLIVMFVDSYDVILAGGPVELLQKFQQFDSNLV
FSAESFCWPEWSLAEKYPPVAVGNRFLNSGGFIGYASVINRVVQLWKYKDDDDDQLFYTR
IYLDPALREKYGITLDHKSKIFQNLNGAIEEVVLKFEPIRVRARNVAYDTLPVVIHGNGP
TKLQLNYLGNYIPNVWTYEGGCEVCDQGLLDLSSLADDSYPHVLIGVFIEQPTPFLPEFL
QRLLTFDYPYSRLSLFIHNREVYHEQHIQAEWEHLQGAFDSIKLVGPEEEMSEGEARDMA
MDLCRQDLACGYYFSLDADVVVVNPEILQILIQDNKKVIAPMMSRHGKLWSNFWGALSPE
GYYARSEDYVELVQGKRIGVWNVPYISQAYLLRGETLRSELVQQHVFTLDDMDPDMAFCK
SVREKGIFLHISNRDEFGRLLSTASFNTSRLHPDLWQIMENPLDWQEKYIHENYSQVLEG
ESHMQPCPDVYWFPVFTDQMCDELVEEAENFGQWSGGKHEDTRLAGGYENVPTVDIHMNQ
IGFEKEWLRFLQEYIAPVTEKLYPGYYTKARAIMNFMVRYRPDEQPFLRPHHDSSTFTIN
IALNHKGVDYQGGGCRFIRYNCTVESPRKGWSLMHPGRLTHYHEGLPTTSGTRYIMVSFV
DP
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtggaagttcagacctgaaagcaacagcccggtgatgtgggctagcaaaggg
aagctgctggtactgacggcagccacggaggagacggaagggtaccagcgcttcctacga
acaaccaaatacttcaactacacggtcaagactcttggcctaggggaggactggaaggga
ggggatgttgcccggacggttggcggagggcagaaagtccgctggctgaaggcagaaatg
aagaagtatgtcaatgaggaagacctgatagtcatgtttgtggacagctatgacgtgatc
ctggccggcggccccgtcgaacttctgcagaagttccagcagttcgacagcaacttggtc
ttctcggcggaaagcttctgctggccggagtggtcgctggcggaaaagtaccccccagtg
gctgtgggaaaccggtttctcaactccggaggattcattggctatgcttccgtcatcaat
cgcgttgtccagctatggaagtacaaggatgacgacgacgaccagctcttctacacgcgt
atttacttggatcctgccttgcgggagaaatatgggatcaccctggatcacaagtcaaaa
atctttcagaacctgaatggcgccattgaggaagtcgttctgaagttcgaaccgatccgg
gtgcgtgcccgaaatgtcgcctacgacaccctacctgttgtcatccatggcaatggccct
accaagctgcagctgaactacctggggaattacatccccaatgtctggacatacgagggg
ggttgtgaagtgtgtgaccaaggactcctggacctgtcaagcttggcggacgactcctat
ccccacgtgctcattggcgtgttcatcgagcagccgactcccttcctgcctgagttcctt
cagcgtctcctgacctttgattacccttactctcgcctcagcctcttcatccacaaccgg
gaggtgtatcacgagcagcacatccaggccgagtgggagcaccttcagggggccttcgac
agcatcaagctcgtgggtccagaggaggaaatgagtgagggcgaggccagagatatggcc
atggacctctgccgccaggaccttgcctgtggctattacttcagcctggatgccgacgtg
gtcgtggtgaaccccgagatcctgcagattctcatccaggataacaagaaggtgatcgct
cccatgatgtcccggcatggaaagctctggtccaatttctggggggccctgagccccgaa
ggatactacgcccgctcggaggactacgtggaactggtgcagggcaagaggataggtgtg
tggaacgtcccttacatctcccaggcttacttgctgaggggggagacgttacgcagcgag
ctggtccagcagcacgtcttcactttggacgacatggacccggatatggctttctgcaag
agtgtgcgggaaaagggtatcttccttcacatcagcaaccgggacgagttcgggcgtctc
ctttccaccgccagcttcaacacatcccgtctgcatccggacctctggcagatcatggag
aaccccctggactggcaggagaaatacatccatgagaattactcacaagtgctggagggg
gaaagccacatgcagccgtgccctgacgtttactggttcccagtgttcaccgaccagatg
tgtgatgagctggtggaagaggctgaaaactttggccagtggtcgggggggaagcacgag
gacaccagactggctggcggctacgagaacgtcccgactgtcgatatccacatgaatcaa
attggctttgagaaggagtggctccggttcctacaagaatacatcgcgcccgtcacagag
aagctctatcctggctactacaccaaggctcgggcaatcatgaacttcatggtccggtac
cgacctgatgagcaacccttcctccgtccacatcacgattcatccactttcaccatcaat
attgctctcaaccataaaggagtggactatcagggcggaggctgccggtttatccgctac
aactgcactgtggaatccccccgcaagggctggagcttgatgcaccccggacgcctcact
cactaccacgaaggactgcccacgaccagtggcacccgctacatcatggtctcttttgtg
gacccctaa

DBGET integrated database retrieval system