KEGG   Gekko japonicus: 107118322Help
Entry
107118322         CDS       T04299                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gja  Gekko japonicus
Pathway
gja00020  Citrate cycle (TCA cycle)
gja00310  Lysine degradation
gja00380  Tryptophan metabolism
gja01100  Metabolic pathways
gja01200  Carbon metabolism
Module
gja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gja_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107118322 (DLST)
  09105 Amino acid metabolism
   00310 Lysine degradation
    107118322 (DLST)
   00380 Tryptophan metabolism
    107118322 (DLST)
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     107118322 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 107118322
NCBI-ProteinID: XP_015276111
LinkDB All DBs
Position
Un
AA seq 464 aa AA seqDB search
MLWLSLARARCLNRAFGRSLGAVRQGSCPQGKCSLSGISQCQGPVYANSRKHLVNGSRVF
TVRYFRTTAACREDVVTVNTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQV
PAPTAGVIEALLVPDGGKVEGGTPLFKLRKSGAAPAKAKQAAAPSTPAPEPAVAAAPAAA
PPPAAPVPTTMPPVPPVSTQPIYAKPVSAVKPSAAPPGAPAVEPGAGKGARSEQRVKMNR
MRQRISQRLKEAQNTCAMLTTFNEIDMSMIQEMRARHKETFLKKHSLKLGFMSAFVKAAA
FALQEQPTVNAVIDDTTKEIVYREYVDISVAVATPRGLVVPVIRNVETMNFADIERSISE
LGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGK
AEVRPMMYVALTYDHRLIDGREAVTFLRKIKAVVEDPRVLLLDL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctttctctggcccgggctcgttgtctcaaccgggcgttcggccgctctctc
ggcgccgttcgacagggaagttgtccacaggggaaatgctcgctctctggtatttctcaa
tgccaaggaccagtttatgccaacagcaggaagcatttagtaaatggctctcgtgtcttc
actgtccgttatttcagaaccaccgcagcatgcagggaagacgttgttaccgtgaacaca
ccagcatttgcagaatcagtcacagaaggagatgtcaggtgggagaaagctgtgggagac
acagtagcagaagatgaagtggtatgtgagatagaaacagacaagacatctgtgcaggtt
ccagctccaacagctggtgtaattgaagcacttctggtccctgatggggggaaagtagaa
ggaggaacacccctgttcaaactcaggaaaagcggagctgcacctgctaaggcaaaacaa
gcagcagctccttcaacccctgccccagaacctgcggtggctgcagcccctgctgctgca
cctccccctgcagcaccagtccccactacgatgcctccagtgccccctgtgtcgacacag
cctatttatgctaaaccagtgtctgcagtaaagccatctgcagctccaccgggtgctcct
gctgtggaacctggggccggcaaaggtgccagatcggagcagagggtgaaaatgaacagg
atgcgtcagcgtatctctcagcgcttgaaagaggctcagaatacatgtgccatgctgact
acctttaatgaaattgacatgagtatgattcaggaaatgcgagctcggcacaaagaaacc
ttcctgaagaagcacagtctgaagcttggctttatgtctgcctttgtgaaagctgcagcc
tttgccttgcaagagcagcccactgtaaacgcagtgattgatgatacaaccaaagagatc
gtatacagggaatatgtggatatcagcgttgccgttgcaactcccaggggtctcgtggtg
ccagtcatcaggaatgtagaaacaatgaactttgctgatattgaacgaagcatcagtgag
ctgggagagaaggcacgtaaaaatgagcttgccattgaggatatggatggcggcacattc
accatcagtaatggtggcgtatttggatccctttttgggacacccatcatcaacccccct
cagtcagctatcctgggcatgcatggcatctttgatagacctgttgctattggaggcaaa
gctgaagtgcgaccaatgatgtatgtggccctgacctacgatcaccggttgattgatggg
agagaggcagtgactttcctgcgtaagatcaaggctgtggtggaggatcctcgtgtgctg
ctgcttgacctgtag

DBGET integrated database retrieval system