KEGG   Gekko japonicus: 107118458
Entry
107118458         CDS       T04299                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
gja  Gekko japonicus
Pathway
gja04141  Protein processing in endoplasmic reticulum
gja04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107118458 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107118458 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107118458 (ATF6B)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107118458 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_Maf bZIP_2
Other DBs
NCBI-GeneID: 107118458
NCBI-ProteinID: XP_015276290
LinkDB
Position
Un
AA seq 690 aa
MAALASELLLLSDSSRFRADNLLSSEDWDTGLYSCLDEDRDVAAELFPCLERSVVDTEED
HCMLTNGFDLDMETLPPDPPWDPLHDTLFPELQVKSEPVSPASSHCSDSSAATSSSSSSS
SSSSADFPGQAPSPADVIGVKTEHPPTPPCMFGDVLSPPFGTVHISVVPAPDTGKAAAPN
KAESILSRKPPIQPKPVVVTTVPVQPATAPSKTILLQPVPATQSQTINSGIAAQSVVISQ
SELLHLPVSGLIKVQSPVTEGLPAKPTPSAPKPEAKTIVPAPAQIGSCSPEIDLKVLKRQ
QRMIKNRESACQSRRKKKEYLQGLEARLREALADNERLRRENALLRRRLDCVLNENGDLK
LGSGNRKVICVMVVLLFIAFSFGPVSISERKVADVEPPKQEAEAGPSRRHLLGVTEESLE
VPEEELPERQEEAPAKPAKTPFRNLSAPFSDMKDLMLRDLDKLFLASDCRQFNRTESIRX
ADELSGWVRRHQINGRKPSQSRKAAQAGQEKNKEKKPLSPSRYVPASPPRHPERDPLSQL
QVYQHPDHKEHDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMALNE
SLYSSSLGYEVMMQIDCEVMDTRVIHIKSSTVPPFLRRQEATPDNRTQPSPPAFSGRTTR
AALRSHRPTLSSSARRQPHRTLYLGEHAGE
NT seq 2073 nt   +upstreamnt  +downstreamnt
atggcggcgctggcttcggagctgctgcttttgagcgactcaagccgcttccgcgcggat
aacctgctcagcagcgaggattgggacacgggtctctacagttgtctggatgaagacaga
gatgtggcagcagaacttttcccttgtctggagcgaagtgttgtggatactgaggaagac
cattgtatgctcaccaatgggtttgacctggacatggaaacgctaccgccggaccctccg
tgggaccccctacatgacaccctctttccagagctgcaggtaaagtctgagccagtctcc
ccggcctcgtctcactgctccgactcgtctgctgccacctcctcctcctcctcctcctcc
tcttcctcatctgctgatttcccaggacaggcccccagcccagctgacgtgatcggggtg
aagacggagcaccccccaacacctccgtgcatgttcggagatgtcctgtcgccccccttt
ggcactgtacacatcagtgtcgtcccagcaccggacacagggaaagctgcagcccccaac
aaagcagagagcattctcagccggaagccccccattcaacccaaacctgttgtggtcacc
actgtgccagtgcagccggcgactgctcccagtaagactatcttactgcagcctgtccct
gccacccagtcgcagacgatcaactctggaatagcagcccagagtgtcgtgatctcccag
tccgaactgctgcacctcccggtgtccggcctgatcaaggttcagtcccctgtgacggaa
ggtctccccgcaaagcccactccctctgcccccaagccggaagccaaaaccattgtcccg
gcacccgcacaaataggatcctgcagcccagagattgatctgaaagtgttgaagcggcag
cagcggatgattaagaaccgcgagtcggcttgccagtcccggaggaaaaagaaggaatac
ctgcaggggctggaagcccggttgcgggaagccctggcagacaacgaaaggctgcggcgg
gagaatgccctcctccgacggcggctggactgcgtcctcaacgagaacggagatctgaag
cttggctctgggaatcggaaagtcatctgcgtcatggtggtgctgctcttcatagccttc
agttttgggcctgtcagcatcagcgagcgaaaagtggcagacgtggagccgcccaagcag
gaagcggaggccggtcccagccggaggcaccttctaggcgtcacagaggagtctctggaa
gtcccggaggaggagctgcctgagcggcaagaggaggccccggccaagcctgcaaagaca
ccgttccgaaacctgtctgctcccttctcggacatgaaggacctcatgctgagggacctg
gacaaactattcctggcttccgactgccgccagttcaatcgcaccgaatcaatccggtag
gcagacgagctcagcgggtgggtccgaagacatcagatcaatgggaggaagccctcgcag
tcacggaaagctgcgcaggccggccaggagaagaacaaggagaagaagcccctgagccct
tcccgctacgtccctgccagcccccccaggcacccagagagggatcccctgagccagctg
caggtgtatcagcatcctgaccacaaggagcacgacttcatggacgctattgatcggcgc
gaggataccttctatgtggtgtcgttccgcagggaccatttactgctgcctgccatcagc
cacaacaaaacctctcgcccaaagatgtccttggtgatgcccgccatggcccttaatgaa
agcctgtacagttcctcgctgggctacgaggtgatgatgcaaatcgactgtgaggtgatg
gacacccgcgtcatccacatcaagagctcgacggtgcctcccttcctgaggcgccaggag
gccacccccgacaaccgcactcagccttcccctccggccttctccggacggacgacccgg
gcggctctgcggtctcatcgccccaccttgtcctcttcggcccggcggcagccgcatcgc
accctatacctgggagaacatgccggggagtag

DBGET integrated database retrieval system