KEGG   Gekko japonicus: 107118762
Entry
107118762         CDS       T04299                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107118762 (TGFA)
   04012 ErbB signaling pathway
    107118762 (TGFA)
SSDB
Motif
Pfam: DUF1180 Insulin_TMD
Other DBs
NCBI-GeneID: 107118762
NCBI-ProteinID: XP_015276609
LinkDB
Position
Un
AA seq 160 aa
MVSAVASELSLLTLGILLALCHALENTTLALSGPPVAAAVRSHFNSCPDAHSQFCFHGTC
RFLVQEDKPTCLCHSGFMGTRCEHADLLAVVAANQKKQTITALVVVSVVASAVLIMVCVL
IHCCRIKKRCEWCRTVVCRHEKPNGLLKGGTSCCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcagcgccgtcgcctccgagctctccctgctcaccctcggtattctattagccctg
tgccatgccttggagaatacaacattggccttgagtggtcccccagtggctgctgctgtc
agatctcattttaacagctgtccagatgctcatagtcagttctgcttccatggtacttgc
aggttcttggtgcaagaggataaacccacttgcctttgtcattctgggttcatgggaaca
cgctgtgaacatgcagatctccttgcagtggtagctgctaaccagaagaaacaaaccata
actgccttggtggtggtctcagtagtagcatcagctgtacttatcatggtctgcgtactg
atacattgctgcaggataaaaaaacgctgtgagtggtgcaggactgtagtctgcaggcat
gaaaagcccaacgggctcctgaaaggaggaacatcttgctgccactctgagacagttgtc
tga

DBGET integrated database retrieval system