KEGG   Gekko japonicus: 107118765
Entry
107118765         CDS       T04299                                 

Definition
(RefSeq) interleukin-1 beta-like
  KO
K04519  interleukin 1 beta
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04060  Cytokine-cytokine receptor interaction
gja04217  Necroptosis
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107118765
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107118765
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107118765
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107118765
   04621 NOD-like receptor signaling pathway
    107118765
   04623 Cytosolic DNA-sensing pathway
    107118765
   04625 C-type lectin receptor signaling pathway
    107118765
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107118765
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107118765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gja04052]
    107118765
   00536 Glycosaminoglycan binding proteins [BR:gja00536]
    107118765
Cytokines and growth factors [BR:gja04052]
 Cytokines
  Interleukins
   107118765
Glycosaminoglycan binding proteins [BR:gja00536]
 Heparan sulfate / Heparin
  Cytokines
   107118765
SSDB
Motif
Pfam: IL1 IL1_propep SRA
Other DBs
NCBI-GeneID: 107118765
NCBI-ProteinID: XP_015276613
LinkDB
Position
Un
AA seq 280 aa
MDRVPECQEEMMEFCSMNEDIPFYEEDQPCLAKNASQSQRQCASCSQVHCACELDIQVKI
SKTVPTKGFRKAVVIVVAVEKMKMNARSKVFTDDDLLDILNTILEPVSFENYELTYATDS
FYRFSGAFSYDIQDIKQRSLVLNQPAQLVAMHLQGTNFDRAVRLEMAVYRRKDQQVKNPI
ALGIKGSGLCLSCVPKEGAEGQPELQLEKESIFRHIDRSKLGRFIFFRIDVGNTTRFESA
AFPGWFICTSSQPDKAVGMTDQPGEVSIIDYALTNQKRLG
NT seq 843 nt   +upstreamnt  +downstreamnt
atggacagagtcccagaatgtcaggaggagatgatggagttctgcagcatgaatgaggat
ataccattctatgaagaagaccagccttgcttggctaagaatgcctcccagagccagaga
cagtgtgcttcctgctcccaagttcactgtgcctgtgagctggacattcaggtgaagatc
tccaagacggtcccaaccaagggcttcaggaaagctgtggtgattgtggttgctgttgag
aagatgaagatgaatgcaagatccaaggttttcactgatgatgatttgctggacatccta
aacaccatcttagaacctgtgtcttttgaaaactatgaattgacttacgcgacagattcc
ttttaccgcttctccggagccttctcctatgatatccaagacattaagcaaaggtccctt
gtcctcaatcagccggcacaactggtggccatgcacctccaaggcactaactttgatcgg
gcagtgaggctagaaatggctgtataccgtcgaaaagaccaacaggtaaagaatcctatt
gcactgggaatcaaagggagcggtctctgcttgtcatgtgtgccaaaagagggagcagaa
gggcagccggagctacagctggagaaagaaagcatctttcggcacattgacagatccaag
ctgggccgcttcatcttctttaggattgatgtcgggaacaccacgcgatttgaatcagca
gctttccctggctggttcatctgcacctcctcccagcccgacaaagctgttggcatgact
gaccagccaggggaagtctcaatcatagattatgctctcaccaaccaaaagcggttgggt
taa

DBGET integrated database retrieval system