KEGG   Gekko japonicus: 107118778Help
Entry
107118778         CDS       T04299                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
gja  Gekko japonicus
Pathway
gja00052  Galactose metabolism
gja00500  Starch and sucrose metabolism
gja01100  Metabolic pathways
gja04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107118778
   00500 Starch and sucrose metabolism
    107118778
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107118778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107118778
Enzymes [BR:gja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107118778
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107118778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107118778
NCBI-ProteinID: XP_015276627
LinkDB All DBs
Position
Un
AA seq 950 aa AA seqDB search
MHLMKWAFFQDRSHHRRPLSARNMKSYQKLAADDPRTTESWDEAADEKPLCHQKLSAWWM
GGGLLMVAALLSGVTVWVLGQIWWSQHTVPPLTQCTSIPENLRFDCYPERGTVVTRELCE
KRGCCFVETGPPSGGARGVPWCFYPPNFPSYALGSVNETQLGMVGFLTRRTKTYYPRDIE
KLRLVVEFETDTRLHVKIIDAAGPRYEVPIEVPQVTKKAENPVYTVEFSKDPFGLIVKRR
TSGAVLINTTVAPLFFADQFLQISTLLPSKFLYGLGEHRSNFLHSLEWNTLTFWARDIPP
TESSNLYGVHPFYLVMEDGGSAHGVFLLNSNAMEVSLQPAPALTWRTIGGILDFYIFLGG
DPNLVVLXQYQQVIGFPAMPPFWALGFHLCRWGYNTSNGTWEVIKAMRNYQIPQDTQWND
IDYMDSNRDFTADPQKFNTLPQMVEDLHKHGQHYVMILDPGISSTYPPGSYWPYDEGLKR
GIFINTTEGKPLIGQVWPGLTAFPDFSNPNTHQWWLENLNNFHAQVPFDGVWIDMNEPSN
FLDGSQEGCSQGELDRPPYVPAVTGGSLFSRTICASARQSTSIHYNLHSLYGLMEAKATA
SALIKIRGKRPFVISRSTFPSQGKYSGHWLGDNRSEWKDMFWSIPGLLSFGLFGVPLIGA
DICGFWGSPSEELCVRWMQLGAFYPFSRNHNTMGGKAQDPTVFSPAARTAMKEALETRYT
LLPFLYSLFHRAHLQGDTVARPLFFEFPKDMATYSVDKQFLWGRGLLVTPVLDPGVDSVI
GYFPRGVWYDYYTGSPVNSSGENLKMEAPLDRINVHLREGTILPTQKPATSTSASRRNPL
RLIAALSPNANAWGDLYWDDGESLDTFEKGDYSYLVFNVTQNTFLSTVLHSNVEATYITV
EELTVYGVQNEPKSVTVNGKETPFSYLENQVLSVGNLQLNLSHGFSIRWM
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgatgaagtgggccttcttccaagatcgatcacaccatcgtcggcctttaagc
gcacggaatatgaaatcctatcagaagctggccgccgatgacccccggaccacggagtcg
tgggatgaagccgccgacgagaaacccttgtgccaccagaagttgtcggcctggtggatg
ggcgggggtctcctgatggtcgccgccttgctcagcggggtgaccgtttgggtcctcggt
cagatctggtggagccagcacacggtgcccccccttactcagtgcacctccatccccgaa
aacctgcgcttcgactgttacccagagaggggcacggtggtgacgagagaactctgcgag
aagcgggggtgctgcttcgtagaaactggcccgccctcgggcggtgcgaggggggtcccg
tggtgcttttacccccccaatttccccagctacgccttggggagcgtcaatgaaacacaa
ctgggaatggtgggcttcctgaccaggcggacaaagacttattatccgagggatatcgag
aagctgcggctcgtcgtggagtttgaaacggacacccgcttgcatgtcaaaattatcgat
gctgccggccctcggtacgaagtgccaatcgaagttcctcaggtgacgaagaaggcagag
aaccccgtgtacaccgtcgagttctccaaggacccctttgggttgattgtgaagcgccgg
acttcaggggctgtgctgataaacacaacggtggcgcccttgttctttgcggatcagttt
ctccagatttctactctcctgccttccaaattcctgtatgggcttggggaacatcgaagc
aacttcctccatagcctggagtggaacaccttaaccttctgggcccgagacatccctccc
acggagtcctccaacctctacggcgttcaccctttttacctggtaatggaagacggtgga
agcgcccacggagttttcctcttgaacagcaacgcgatggaggtgtccctgcagccggca
cctgccctcacctggagaaccatcggaggcattctggatttctacatctttttgggaggg
gatcccaacttggtggttctgtagcagtaccagcaagtaatcggatttccagccatgccg
ccattttgggccctgggtttccatctctgccgctggggatacaatacaagcaacgggact
tgggaggtcataaaggcgatgcggaattatcaaatcccccaggacacacagtggaatgat
atcgactacatggatagcaatcgggacttcactgctgacccccagaagttcaacaccctc
ccccagatggtggaagacctgcacaagcacggacagcattacgtgatgattctggatccg
gggattagtagcacgtatcccccaggctcttattggccgtatgatgaaggcttgaagcgt
ggaatattcatcaacactaccgaagggaaacctctgatagggcaggtctggcctggcctc
actgctttccccgatttctcgaacccgaacactcatcagtggtggttggagaacctgaac
aatttccacgcccaagttccctttgatggcgtttggattgacatgaacgagccatccaac
tttctggacggatcccaggaaggttgttcccagggagaactggacagacccccctacgtg
cctgccgtaacgggaggctcccttttctccagaacaatctgtgcctcggccaggcaaagc
acctccattcactacaacctccacagcctctacggattgatggaagccaaagccaccgcc
agcgctttaatcaaaatccgagggaaacggcccttcgtcatctcgcgctccaccttccca
agccaagggaagtattcgggacactggctcggagacaaccgaagcgagtggaaggacatg
ttctggtctatcccaggtttactgagttttggtctctttggagtcccgctaatcggggct
gatatctgcggcttctggggctctccctccgaggagctgtgcgttcgctggatgcagctc
ggcgccttctatccgttctcacgaaaccacaacaccatgggcgggaaggcccaggacccc
actgtgttcagccctgcagcacggaccgccatgaaggaggccctggagacccgttacacc
ctcttgccgttcctctattccctcttccaccgggcacacctgcaaggtgacaccgtcgcc
cgaccattgttttttgaattcccaaaagacatggccacctactcagtagacaagcagttt
ctgtgggggaggggcctgttggtgaccccagtgctggatcccggcgtggactccgtgatc
ggctacttcccgagaggcgtctggtacgattactacacgggctccccagtgaacagcagc
ggggagaacctcaaaatggaggcaccgctggaccgcatcaacgtacacctccgcgagggg
accatcctgcccactcagaaaccagccaccagcacttcggcgagccgcaggaaccccctg
cgcctgatcgcagccctgtcgcccaacgccaacgcctggggagacctgtactgggatgac
ggcgagagcctggacacctttgagaagggcgactattcctacctggtgttcaacgtcacg
cagaacaccttcctttccactgtcctgcattccaacgtggaagcgacttacatcaccgtg
gaggagttgacagtctacggggtccagaatgagccaaagagcgtgaccgtcaacgggaag
gagacacccttctcctatttggaaaaccaggttctctctgtgggcaacctgcagctgaac
ctcagccacggattctccatacgatggatgtga

DBGET integrated database retrieval system