KEGG   Gekko japonicus: 107118965
Entry
107118965         CDS       T04299                                 

Definition
(RefSeq) prostaglandin D2 receptor-like
  KO
K04332  prostaglandin D2 receptor
Organism
gja  Gekko japonicus
Pathway
gja04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107118965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gja04030]
    107118965
G protein-coupled receptors [BR:gja04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    107118965
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 107118965
NCBI-ProteinID: XP_015276858
LinkDB
Position
Un
AA seq 300 aa
MEDRPPYRCRHHRSLASGQSALPGSLLFAAGLVGNVLQLGLLWHHQLRARLERGGRPARA
SPFYLLVSALAATDLLGKCLLSPIVLAAYARNRSLSQLWPSGEEGDAAVGGDGDAPPGRL
CQLFAFLMAFFGLAPTALLLAMALECWLSLGRPYFYERHASRRRGALLTGAAVALCALPP
RTGAQGAARPPRLSAAARVEELRHLVLLALMTVLFVVCSLPVIIRAYIGAFAPDDDENAD
LTALRFFSVNSIVDPWVFIIFRTSVFRTCLHRVSRRLSSKRASHSQLLETSTRKDSGQPQ
NT seq 903 nt   +upstreamnt  +downstreamnt
atggaggatcggccgccttaccgctgccgccaccaccggagcctggcgagcgggcagtcg
gcgctgccgggctcgctgctcttcgccgccgggctggtgggcaacgtgctgcagctgggc
ctcctgtggcaccaccagctgcgcgcccggctggagcgcgggggccgcccggcgcgggcg
tcgcccttctacctgctggtgagcgccctggccgccaccgacctgctgggcaagtgcctg
ctcagccccatcgtcctggccgcctacgcgcgcaaccgcagcctcagccagctctggccg
tccggggaagagggggacgccgccgtcggaggagacggagacgcgccgccgggccggctg
tgccagctcttcgccttcctgatggccttcttcggcctggcgcccaccgccctgctcctg
gccatggcgctggagtgctggctctcgctgggccggccctacttctacgagcgccacgcc
agccgccgccggggggccctcctgaccggcgcggccgtggccctgtgcgccctcccgccg
cgcaccggcgcgcagggggcggcgcggccgccgaggctctcggccgccgcccgcgtggag
gagctgcgccacctggtcctcctggcgctcatgaccgtcctcttcgtcgtctgctccctg
ccggtgatcatccgtgcttacatcggagctttcgccccggatgacgacgagaacgccgac
ctcaccgccctccgttttttttccgtgaactccatcgttgacccctgggtcttcatcatc
ttccggacgtcggtgtttcgcacatgcctccaccgggtctcgaggaggctgagttcaaag
agagcctcgcactctcaactcctcgaaacgtcgacccggaaggattccgggcagccgcag
tga

DBGET integrated database retrieval system