KEGG   Gekko japonicus: 107119447
Entry
107119447         CDS       T04299                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
gja  Gekko japonicus
Pathway
gja00220  Arginine biosynthesis
gja00330  Arginine and proline metabolism
gja01100  Metabolic pathways
gja04020  Calcium signaling pathway
gja04146  Peroxisome
gja04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107119447 (NOS2)
   00330 Arginine and proline metabolism
    107119447 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107119447 (NOS2)
   04020 Calcium signaling pathway
    107119447 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107119447 (NOS2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107119447 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 107119447
NCBI-ProteinID: XP_015277399
LinkDB
Position
Un
AA seq 1086 aa
MNQISGCPRYLTIKNWENGTSLQDTLHHQAKEALDCKAKVCRGSLMNPKGLVRGLRDGPT
LPDELLPQAIEFINQFYHSCKRPQIKEHLSRLEAVAKEIEATGTYQLTMEELNFAARQAW
RNAPRCIGRIQWSNLQVFDARSCATAKEMFEHLCRHLEYSTNGGNIRSTITVFPQRTDGK
HDFRIWNIQLIRYAGYQMTDGSIVGDPANVEFTQLCIQLGWKAKYGRFDVLPLILQANGQ
DPELFELPPELVLEVSMEHPTYEWFRELGLKWYAVPAVSNMLLEVGGLEFTACPFNGWYL
GTEIGVRDYCDVHRYNILQEVGRRMGLETNKPSSLWKDRAVTEVNVAVLHSFQEQNVTIM
DHHSAAESFMKYMQNEYRIRGGCPADWVWLVPPISGSITPVFHQEMLNYVLSPFYYYQVD
AWKTHIWKDEERKPRKKDIKFCILAKAVFFASSLMRRAAAARIKVTILYATETGRSETLA
HHLGDLFSCAFSPKVICMDSYNLSDLEKETLLLVVTSTFGNGDSPSNGKKVKNALLTTKQ
LSNKFRYAVFGLGSSMYPEFCAFAHAVDQKLAQLGASPVTLTGEGDELNGQEEAFRVWAV
NTFKSACEIFDIRGKHSLQLPKAFTCNETWDPKDFRIVYDSQPLDLEKALGDIHGKNVIL
TKLKFRHNLQSLQSSRTTLLIELSCKTNQEIQYLPGDHLGIFPSNQKALVDGIMACVADA
PPSDQTIRLETRCDRGYWTADKKFPACTFSQALTYFLDVTTPPSQQMLRRLSQVAGGDGD
KARLGLLGQSLEEYNKWKFHNSPTILEVLEEFPSIEISASFLLSLLPLLKPRYYSISSSP
DWEPKELHLTVAVVTFRTRGGKGPVHHGVCSTWLNTVDLRETIPCFVRSANGFRLPKDPS
KPCFLIGPGTGIAPFRSFWQQRLYDLEQKGIKGRGMTLLFGCRCSNLDHLYKEEAQEMKR
RGVLQEVYTAYSREDGQPKVYVQDLLRTRLNADVHRLLHEEKGHLYVCGDVCMARDVAQT
LKEMFAKRLGLTDEQAEDYVFQLKRQKRYHEDIFGAVFLHESQTDSEESKSNCNTSSARS
QPQLTF
NT seq 3261 nt   +upstreamnt  +downstreamnt
atgaatcagatttctggctgtccaagatatttaaccattaaaaactgggaaaatggaaca
agcctacaagacacactgcatcaccaggccaaagaggctcttgactgcaaggctaaagtt
tgccgggggtctctcatgaacccaaaaggtttggtcagaggccttcgagatggacccacc
ctccccgatgagctcttacctcaagcaatagaattcatcaatcagttctaccattcatgt
aaacggccccaaataaaggagcacttgtcccgcctggaagctgtagccaaggagattgaa
gccacaggaacttaccagctgactatggaagagcttaactttgcagccaggcaagcctgg
agaaacgccccaagatgtattgggagaatccagtggtccaatttacaggtgtttgatgct
cgtagctgtgccactgccaaggaaatgtttgagcacctctgtcgacacttggagtactcc
accaatggtgggaatatacggtccaccatcactgtctttccccaaaggacagatgggaaa
catgacttccgtatatggaacatccaactcatccgttatgccggctaccaaatgactgat
gggtccattgtgggagatccagccaatgtggagttcacacaattatgcattcagcttggt
tggaaggccaaatatggccgctttgatgtgcttccattgattctgcaagccaacggccaa
gacccagagttatttgaactgccgccagagctcgtccttgaagtgtcgatggagcatccc
acgtacgagtggttcagagagctgggcctgaagtggtacgcagtcccggcggtctcaaac
atgctccttgaggttggaggcttggagtttacagcctgcccgttcaatggctggtacttg
gggactgaaatcggggtacgggattactgtgatgttcaccgctacaatatacttcaggag
gtggggaggaggatgggcctggaaaccaacaagccctcctccctctggaaggacagggct
gtgaccgaggtgaatgtcgctgtcctgcacagcttccaggaacaaaatgtcaccataatg
gaccatcattctgctgctgaatcctttatgaagtacatgcagaatgaatatcggatacga
ggaggatgtccagctgactgggtttggcttgtccctcccatctcaggcagtatcacacct
gtcttccaccaggagatgttgaattacgtcctctcccctttctattactatcaggtggat
gcttggaaaacgcacatctggaaagatgaggagcggaagccgaggaaaaaagatatcaag
ttttgcattttggcaaaggctgtgttttttgcttcctcgctgatgcggagagctgcagct
gccaggataaaagtgaccatcctctatgccacggagacggggagatccgaaacgctggcc
caccatctgggtgatctgttcagttgtgctttcagtcccaaggtcatctgtatggacagc
tacaatctaagtgacctggagaaagaaactcttcttctggtcgtgaccagcacttttgga
aatggtgattcaccaagcaacggaaaaaaagtgaagaatgctctgttgactacgaaacag
ctcagtaacaaattcagatacgctgtatttggcttggggtcaagcatgtatccagagttt
tgtgcctttgcccatgctgttgaccaaaagcttgcacagctgggggcctcgccagtcacc
ctgacaggagaaggggatgaacttaatggacaggaggaagcttttcgcgtctgggccgtt
aatacattcaagagtgcctgtgaaattttcgacatccgtggaaaacacagcctccagttg
cccaaagcgttcacctgcaacgaaacctgggatcccaaagattttaggattgtgtatgac
tctcagccgctggatttggagaaagcacttggtgacatacatgggaaaaatgtgattcta
acaaagctcaaatttcggcacaatctgcaaagtttacagtccagccggacaacgcttcta
attgaactttcctgcaagactaatcaggaaatccaatatctccctggagaccatctcgga
atcttccctagcaaccagaaagctctcgttgatggaatcatggcctgtgtcgcggatgcc
cctccgtctgatcagaccatcagactggaaacacgctgtgaccggggctactggactgct
gacaagaagtttccagcctgcaccttctcccaggccttgacgtacttcctggatgtcacc
actcccccttctcagcagatgctcagaaggctttcccaggtggccgggggagacggggac
aaggccaggctgggcctcctgggtcagagcttggaggaatacaacaagtggaaatttcac
aacagccctaccattctggaagtcctagaggaattcccatccattgagatctctgcatct
ttcttgctgtctctattgcctttgctaaaacccaggtactactcgatcagttcctcaccg
gactgggaacccaaggagctccatctgacggtcgccgtggtcaccttcaggaccagaggt
ggaaaaggtcctgtgcaccacggggtatgcagcacctggctgaacactgtcgacctgaga
gagacaatcccctgttttgtgcgcagtgctaatgggttccggcttccaaaagacccaagc
aagccatgctttctgataggccccggcacagggattgctccgtttcgaagcttctggcaa
cagcgtctctacgacttggaacagaagggcatcaaagggagaggcatgacgctgttgttc
ggctgccggtgctccaacctagatcatctttacaaagaagaagctcaggagatgaagagg
agaggagtgctccaagaggtctacacagcttactccagagaggatggtcagcccaaggtc
tacgtccaagaccttcttcggaccagactcaatgcggatgtacaccggctgttacatgag
gagaaaggccacctgtatgtctgtggagacgtctgcatggcaagggacgtggcacaaact
ttgaaggagatgtttgcgaagcggctgggcctgacggatgagcaagcggaagactacgtc
tttcagctgaagagacaaaaacgctaccatgaagacatttttggggctgtgtttctgcat
gagagccaaactgactccgaagaatcaaaatccaactgcaacacttccagtgcaagatct
caaccacagctaaccttttag

DBGET integrated database retrieval system