KEGG   Gekko japonicus: 107119827
Entry
107119827         CDS       T04299                                 

Definition
(RefSeq) tumor necrosis factor-like
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04060  Cytokine-cytokine receptor interaction
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04217  Necroptosis
gja04350  TGF-beta signaling pathway
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107119827
   04350 TGF-beta signaling pathway
    107119827
   04150 mTOR signaling pathway
    107119827
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107119827
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107119827
   04217 Necroptosis
    107119827
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107119827
   04621 NOD-like receptor signaling pathway
    107119827
   04622 RIG-I-like receptor signaling pathway
    107119827
   04625 C-type lectin receptor signaling pathway
    107119827
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107119827
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107119827
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107119827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gja04052]
    107119827
   00536 Glycosaminoglycan binding proteins [BR:gja00536]
    107119827
Cytokines and growth factors [BR:gja04052]
 Cytokines
  Tumor necrosis fators
   107119827
Glycosaminoglycan binding proteins [BR:gja00536]
 Heparan sulfate / Heparin
  Cytokines
   107119827
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 107119827
NCBI-ProteinID: XP_015277916
LinkDB
Position
Un
AA seq 235 aa
MSSEQLVYDVEKGSNVIVVHDPPRKDSHWKCLSICSFLLLIGAVIVFTLLQFGAFGSSAN
QDSKGNRNPFPEGMPQTLRVQAAASGKPAIHAIASRTHHNNLVWTTRLIPAMTNGMELSE
KDNALVVPSSGLYFVYSQLLFHGSSCQEHVEESLLLTHTIYSMSKVFNGGRVELMKTVKS
VCESEGHNKLWFESIYQGGVFRLQEGDKLLSDTQSVRYLNWDREGQVYFGAIALD
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagctccgagcagttggtatacgatgtggagaaaggcagcaacgtgattgtggtgcat
gacccaccacgaaaagatagccactggaagtgcttgagcatctgttctttcctgctcctc
attggggccgtcatagttttcactctgctgcagtttggagcgtttgggtcctccgcaaac
caggactctaagggaaacagaaaccccttccctgaaggaatgccccagacgttgagagtg
caagccgctgcctctgggaaacctgctatccacgccattgcatccagaactcaccataac
aacctcgtctggactaccaggttgatacccgccatgacgaatggcatggaactcagcgag
aaggacaacgcactcgtggtgccttccagcgggctctattttgtctattctcagctcttg
ttccatggaagtagctgccaagaacatgtcgaagagtccttgctgctcacccacaccatc
tacagtatgtccaaagtgttcaacggaggcagggtagaattgatgaagaccgtcaaatcc
gtctgcgagagtgaaggacacaacaagctgtggtttgaatccatctaccaagggggtgtt
ttccggctgcaagaaggggacaagctgttgtcagacacacaatcggtcagatacttgaac
tgggatcgagagggacaggtgtattttggggccatagcactggattaa

DBGET integrated database retrieval system