KEGG   Gekko japonicus: 107119854Help
Entry
107119854         CDS       T04299                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
gja  Gekko japonicus
Pathway
gja00052  Galactose metabolism
gja00500  Starch and sucrose metabolism
gja01100  Metabolic pathways
gja04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107119854 (GAA)
   00500 Starch and sucrose metabolism
    107119854 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107119854 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107119854 (GAA)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107119854 (GAA)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107119854 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107119854
NCBI-ProteinID: XP_015277954
LinkDB All DBs
Position
Un
AA seq 925 aa AA seqDB search
MILKVLALAAAVTVLSVYGVHDVALAVVMSPATVSQAWDVYRGENKGREEATQELTFVEQ
PESSKVSVLQPTACDIPPDRRFDCAPEKLISQEECQARGCCYVPVSCLDSANGKPWCFFP
LSYPSYRMKNLTATETGYTAQLTRDAPTFFPDNIMNLQLDVMFETEGRLRFSLKDPANKR
FEVPLETPQISIKASSTLYSVQFSADPFGLVVVRKSSGQVLLNTTVAPLFYADQFLQIST
SLPSGFISGLGEHLTSLILNVSWTKVTLWNRDMPPAPSANLYGSHPFYLVLEEGGLAHGV
FLLNSNAMDVILQPSPAITWRTTGGILDFYIFLGPDPKSVVSQYLDVIGYPLMPPYWALG
FHLCRWGYISTAVTKEVVKNMTAAQFPLDVQWNDLDYTDARRDFTFDKDRFRDMPDMVRD
FHHDGRRYVMIVDPGISSSSPPGSYKPYDEGLKQGVFILNATGQPLMGKVWPGPTAFPDF
TNPQAQQWWYDMVKDFHDQVPFDGMWIDMNEPSNFVEGSLDGCPNNKFENPPYVPGVLGR
SLKTHTICASSKQYLSSHYNLHNLYGLTEAIASHDALVRVRGKRPFVISRSTFASHGRYA
GHWTGDIASTWEHLYYTIPAVLLFNLYGVPLVGADVCGFVGDTSEELCVRWTQLGAFYPF
MRNHNDHGNRPQEPYIFSQGAQKAMRKALLLRYSLLPYLYTLFHKAHSAGDTVARPLYLE
FPEDPNTWDIDRQLMWGAALLITPVLEAGKTKVSGYFPLGTWYNTIAGSTIHSKGQWILL
PAPLDTINVHIRAGYILPLQEPALTTTESRTKGMTLVVALTPEGVARGDLFWDDGEGLLT
FEKGDYTQILFLARNGMLVNEIVRLNGQVDGLLLQEVTVLGVPSPPHHVLANGIPVADFS
YRLDSKILNISLSLLMREQFVITWS
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgaaggtgttggctcttgcagcagcagttactgtgctcagtgtatatggagtc
catgatgttgctttggcagtcgtcatgagccctgcaactgtttcccaggcatgggatgtc
tacaggggtgagaacaaaggcagagaggaagcgacgcaagaacttacatttgtagagcag
ccagaatcctccaaagtctctgtcttgcagcctacagcctgtgacatccctccagacagg
cgctttgattgtgccccagaaaagctgatctctcaagaagaatgtcaggctcggggctgc
tgttacgtccctgtctcttgcctggattctgccaatgggaagccatggtgctttttccct
ctcagctaccctagttacaggatgaagaatctgactgctactgaaactggctatactgcc
cagttgacccgtgatgcacccacctttttcccagataatattatgaacttgcaactggat
gtgatgtttgagacagagggtaggctgcgcttctcacttaaagatccagccaacaagcgc
tttgaagtccctttggaaactccccagataagcatcaaggcatcctcaactctctactct
gttcagttctctgctgatccctttggccttgttgttgttcggaaatccagtgggcaagta
ctactcaataccacagtggctcccttgttctatgctgaccagttcctgcagatctcgacc
tccctgccatcaggtttcatctctggactgggcgagcatttgacttcactcatccttaat
gtcagttggaccaaagtcaccctctggaatcgggacatgccacctgcgccctctgcaaac
ctatacggctcgcaccctttctacctggtgctggaagagggtggtttggcccatggagtc
tttttgctgaacagcaatgccatggatgtgatactgcagcccagtccagccataacatgg
agaacaactgggggcatcctggatttctatatcttcctgggcccagatccaaagagtgtg
gtgagccagtatctggatgtcattgggtaccccctcatgcccccatattgggctctggga
ttccatctctgtcgctggggatacatctccactgccgttaccaaggaagtggtcaagaac
atgacagcagcacagtttcccctggatgtacagtggaacgacttggattatactgatgca
aggagagattttacctttgataaggatcggttccgagatatgccagacatggtgcgtgat
ttccaccatgacggtcggaggtatgtcatgattgtggatcctggtatcagcagttccagc
ccccctggcagttacaaaccctatgatgaaggcctgaaacaaggtgtcttcatcttaaat
gcaacagggcagcctctgatggggaaggtttggcccggccccactgccttccctgacttc
accaacccacaggcccagcagtggtggtatgacatggtgaaggatttccatgaccaagtg
ccctttgatggcatgtggattgacatgaatgagccatccaattttgtggaaggttccttg
gatggctgtcccaacaacaaatttgagaaccccccttatgtaccaggtgttctgggaaga
tcgctgaagacacacacaatctgtgcttccagtaaacaatatctgtcctcccactacaac
ctgcacaatctgtatgggctgacagaggccattgcttcacatgatgctttagtgagagtg
cgagggaaacgcccatttgtgatttcccgttccacctttgcaagccatggtcgctatgct
ggccactggactggggatattgcaagcacctgggaacatttatactacaccataccagct
gtgctgctgtttaatctctatggcgtgccattggttggggctgatgtctgtggctttgtg
ggcgacacttcagaagagctgtgtgtgcgctggacccaactaggtgccttctatcccttc
atgcgaaaccacaatgatcatggaaacaggccccaggagccatacatcttcagtcaaggc
gcccagaaggccatgagaaaagcccttctcctgcgctactcgctgcttccctacctctac
actctcttccacaaggcccactctgcaggggacactgttgctcgccctctttatctggag
ttcccagaagaccccaatacatgggacattgaccggcagctcatgtggggagcagcactt
ctcatcacccctgtcctggaagcagggaagacaaaagtcagcggctacttccctttgggc
acttggtacaacacaatagctggatccaccattcacagcaaagggcagtggattctttta
ccagctccacttgacacaatcaatgtccacatacgtgcaggatacatcctgccgctgcag
gagcctgccttaacaaccacagagtcccgcacaaaggggatgaccctcgtggtggctctg
acaccagaaggggtggcgagaggtgacctgttctgggatgatggagaaggactgctgact
tttgagaagggcgactacacacagatcctctttctggcaagaaatggcatgctggttaat
gagattgtgaggctcaacggccaagtcgatgggctgttgctgcaggaagtgactgtgctg
ggtgttcccagccctcctcatcatgtcctggcaaatggcattcctgttgcagacttctct
taccgcttagactctaagatccttaacatctccctttctctgctgatgagggagcaattt
gtcatcacctggtcttga

DBGET integrated database retrieval system