KEGG   Gekko japonicus: 107119990
Entry
107119990         CDS       T04299                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
gja  Gekko japonicus
Pathway
gja04210  Apoptosis
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107119990 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107119990 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    107119990 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    107119990 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    107119990 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    107119990 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107119990 (NFKBIA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107119990 (NFKBIA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107119990 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107119990 (NFKBIA)
   04131 Membrane trafficking [BR:gja04131]
    107119990 (NFKBIA)
Transcription factors [BR:gja03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    107119990 (NFKBIA)
Membrane trafficking [BR:gja04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107119990 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 107119990
NCBI-ProteinID: XP_015278110
LinkDB
Position
Un
AA seq 329 aa
MFTARTVDYPMDYTMDDHPRDLLKKDRQLSLVQDDRHDSGLDSMKDEEYDQLVRDLEDIR
VQPKEACTALQSAPCQPGQAWKQQVTEDGDTFLHLAIIHEEKPLSLEIVRQTGCDRVFLN
FQNKLGQTPLHLAMITDQPEIAEALLKASCNPEIRDFRGNTPLHIACEQGSLRGVGVLTQ
YSSPHHLSSLLHLRNYNGHTCLHLASVQGYLAIVECLLSLGVDVDAKEPCNGRTALHLAV
DLQNEELVSLLLKHGADANKVTYQGYSPYQLTWGRNNSVIQEQLRPFTTLDLQMLPESED
EDSCESESECTEDELLYDDCVIGGRFVPC
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtttaccgcccgcactgtggattatccaatggattatacaatggacgaccatcctcgg
gatctgctgaagaaggaccggcagctcagcctggtccaggacgatcgccacgacagcggc
ttggactccatgaaggacgaggagtacgaccagctcgtccgggacctggaagacatccgc
gtccagcccaaggaagcctgtacggccctgcagagcgctccctgccagccgggccaggct
tggaagcagcaagtgactgaagacggagacacatttctccatctggctattattcatgaa
gaaaagcctctgagtttggaaattgttcgccagacaggatgtgacagagtcttcctgaat
ttccagaataagctaggccagactccacttcacttggccatgatcacagatcagccagaa
attgctgaggctcttctgaaagccagctgtaacccagagatccgggacttccgaggaaac
acacctctgcatatcgcttgtgaacagggatctctgaggggtgttggtgttctcacacag
tactcctctcctcaccacctcagctccctcctccacttgcgcaactacaatggacacacc
tgtctccatttggcatctgttcaagggtatctggccattgttgaatgtctcctgtcctta
ggagtggatgtcgatgctaaggaaccatgcaatggtagaacggccttgcatttggctgta
gatctgcagaatgaagaactggtgtcactcctgttaaaacatggcgcagatgcaaacaaa
gtcacctatcagggctattctccataccagctcacttgggggagaaacaactctgtcata
caggaacagctgaggccatttaccacactggacctacagatgctgcccgaaagtgaagat
gaagatagctgtgaatcagaatcagagtgcacggaggatgaacttctgtatgacgactgc
gttattggaggacgatttgtgccttgttaa

DBGET integrated database retrieval system