KEGG   Gekko japonicus: 107120231
Entry
107120231         CDS       T04299                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04020  Calcium signaling pathway
gja04260  Cardiac muscle contraction
gja04261  Adrenergic signaling in cardiomyocytes
gja04270  Vascular smooth muscle contraction
gja04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107120231 (CACNA1C)
   04020 Calcium signaling pathway
    107120231 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107120231 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107120231 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    107120231 (CACNA1C)
   04270 Vascular smooth muscle contraction
    107120231 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gja04040]
    107120231 (CACNA1C)
Ion channels [BR:gja04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107120231 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 107120231
NCBI-ProteinID: XP_015278355
LinkDB
Position
Un
AA seq 2111 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGAAGNATISTASSTQRKRQQYGKQ
KKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKYPFXPFEIIILLTIFANCVALAIYI
PFPEDDSNATNSNLERVEYLFLIIFTVEAFLKIITYGLLFHPNAYLRNGWNLLDFIIVVV
GXVLAILEQATKADGVNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAM
VPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYLLGVTDTPAEEDPSPCAPHLAHGRQC
QNGTECRAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFV
SLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAED
IDPENEDEGMDEEKPRNMSMPTSETESVNTDNVAGGDIEGENCGARLAHRISKSKFSRYW
RRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQSDWLTEVQDTANKVLLAL
FTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLR
IFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRR
STFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLN
VFLASTVDNVADAESLTSAQKEEEEEKERKKLARTASPEKKQEPEKPAVEGETKEEKIEL
KSITADGESPPSNKSNVDEYQPNENEEKNPYPTTETPGEEEEEEPEMPVGPRPRPMSELH
LKEKAVPMPDASAFFIFSPSNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHS
SVRNQILFYFDIFFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGI
QSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACI
GVQLFKGKLYSCSDSSKQTEAECKGKFITYKDGEVSHPILNIRNWENSKFDFDNVLTAMM
ALFTVSTFEGWPELLYRSIDSHLEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVI
VTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNKYQYKVWYVVNSTYFEYLIF
ILIMLNTICLAMQHYGQSCLFKEAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVF
DFLIVIGSIIDVILSETNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGI
RTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAV
LLLFRCATGEAWQEIMLACLPDKKCDSDSLEQNNSTEDEYSCGSSFAIFYFISFYMLCAF
LIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQ
PPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEEL
RAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQ
RNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGN
HVSYYQSDGRSSFPQTFTTQRPLHINKSSNNQGDTESPSHEKLVDSTFTPSSYSSSGSNA
NINNANNTALSRFPSPPRYPSTVSTVEGHSTPLSPSARIREPPWKLGCRRSCSRDSQVAI
VCEEEPSQEEETYDERLNEEVEYCSEPSLLSTEMLSYQDDEHRQLTPPENCKGEDTRHSP
KSGFLRSASLNRRASFHLECLKRQKNPSAVGPQKTVLPLHLVHQQALAVAGMSPLLQRCH
SPVRASRSCTTPFTTPCTQSWPQQPIKTLQLDGEESNEKLNSSFPSVQCSSLYSDGTNSG
STRKVRPVSLTVPSQTTECGRQFHGSANSLVEAVLISEGLVQFAQDPKFIEVTTQELADA
CELTIEEMENAADNILNGNSKPSPNGKLLPFVNCRDSGQDCMGEEEAAAQNPDCKKSQEE
SKDSRIYISSL
NT seq 6336 nt   +upstreamnt  +downstreamnt
atgaatgccaatgcagctgcagggcttgcacccgagcatatccctactccaggtgcggcc
ctttcctggcaggctgctattgatgctgccaggcaggccaaattgatgggtgctgccggc
aatgcaacaatatctaccgccagctcgacacagaggaagcggcagcagtacgggaaacag
aaaaaacagggtaccaccacagctacacggcctccccgggcattgctgtgtttaacactg
aaaaaccccatccggagggcatgcatcagtattgttgaatggaaatatcctttttgacca
tttgaaattattattttactgactatttttgccaattgtgtggccttagctatctatatc
ccctttccagaagatgattccaacgctaccaattccaatctggaacgagtggaatatctc
tttctcataatttttacagtggaagcatttttaaaaataataacatatggactcctcttt
catcctaacgcttacctccgcaatggctggaatttactagattttataattgtggtagta
gggtgagtacttgcaattttagaacaagcaaccaaagcagatggagtgaattcaatagga
ggcaaaggcgctggattcgacgttaaagcacttcgggctttccgagtattacgcccctta
cggctggtatctggagttcctagccttcaggtggttttaaattccattatcaaggccatg
gtccctttgctgcacattgccctgctggtgctgtttgtcataattatctatgccatcatt
ggactcgagctcttcatggggaagatgcacaagacttgctacttgttaggggtaacagac
acaccggcagaagaggatccctctccttgtgcgcctcacttagcacatgggcggcaatgt
cagaatggcaccgaatgcagagcaggatgggaaggacctaagcacggcattaccaacttt
gacaactttgcctttgccatgttaactgtgtttcagtgcatcaccatggagggctggaca
gatgtcctgtactggatgcaggacgctatgggctatgaattaccctgggtgtactttgtc
agtctggtcatctttggatcctttttcgtacttaatctggttcttggtgtgttgagcgga
gagttttctaaagaaagagagaaggcaaaagctcggggtgactttcagaagttgcgggag
aaacagcagctggaggaggacttgaaaggctacctggactggataactcaagcagaagat
attgacccagaaaatgaagatgaaggaatggatgaggagaagccccgaaacatgagcatg
cccaccagtgaaacagaatctgtgaacactgataacgtggcaggaggtgatattgaggga
gaaaactgcggagcacggctggcgcatcggatctctaaatctaagtttagccgctactgg
cgcagatggaatcggttctgcaggcgaaagtgtcgagctgctgtcaaatctaatgtgttc
tactggctagtgatcttccttgtgtttctcaacaccctcaccattgcctctgaacattac
aaccagtcagactggctcactgaagtccaagacactgcgaataaggtactgctggctctt
ttcacggctgagatgctgctgaagatgtacagcctgggtcttcaggcctatttcgtgtct
ctcttcaatcgctttgactgttttattgtgtgtggaggaatcctggaaaccatcttggtg
gaaaccaaaatcatgtcaccactgggtatctcagtgctgagatgtgtccgactgctgaga
atatttaaaatcacaaggtactggaactccttgagtaacctggtggcttccctgctcaac
tcggtccgctccattgcctccctgctgctgctcctcttcctcttcatcatcatcttctcc
ctcctaggaatgcagctgtttgggggaaagtttaactttgatgagatgcaaaccagaaga
agcacatttgacaactttccccagtcactacttactgtgttccagatcctgactggggag
gactggaattcggtgatgtatgatggaatcatggcttatggcggcccctcttttccagga
atgttggtctgtatttacttcatcatcctcttcatctgtggaaactacatactgctgaat
gtctttttggccagtactgtggacaatgttgctgatgctgagagcctgacatctgcccaa
aaagaagaggaagaggaaaaagaaaggaaaaaactagctaggacggctagtcctgaaaag
aaacaggagcctgagaagccagctgtagagggggagacgaaggaggagaaaattgagctg
aaatcgatcactgctgatggagagtctccgccttctaacaagagcaatgtagatgaatat
cagcctaatgaaaatgaagaaaagaatccctatcctaccacagaaacgccaggagaggaa
gaagaagaagagcctgagatgcccgttggccctcgtccacgtccaatgtctgaactacac
ctcaaagagaaagcagtgccaatgccagacgccagtgcttttttcatcttcagccccagc
aacaggtttcgggtccactgccatcgcatcgttaacaataacattttcaccaacctgatc
ctctttttcatcttgctcagcagcatctctctggcagctgaggaccctgtccgtcactcc
tccgttaggaatcaaatcctcttttattttgatatattttttactgtcattttcaccatt
gaaattgctctgaagatgacggcttatggggctttccttcataaaggatccttctgcagg
aactacttcaacatcctggacctgctggtggttagcgtttctctcatctcctttgggatc
cagtctagtgccatcaatgtggtgaagatactacgagtcttgcgagtgctccgaccactg
agggccatcaacagagccaaaggactgaagcatgttgtccagtgtgtgtttgtagccatc
cggactattgggaacattgtgattgtcaccacgttgttgcagttcatgtttgcctgcata
ggagttcagttgttcaagggcaaattgtacagctgcagtgatagctccaaacaaacagaa
gcagagtgcaagggcaagtttattacttacaaggatggggaggtctcccatccaatactg
aacatccgaaactgggagaatagcaaatttgattttgacaacgtcctcactgccatgatg
gccctcttcaccgtttcaacctttgaaggctggccagaactgctgtatcgatctattgat
tcccatctggaagatgtggggcccatctataaccacagggtggagatctccattttcttc
attatctacatcatcatcatcgctttcttcatgatgaacatcttcgttggtttcgtcatc
gtcacttttcaggagcaaggagagcaggagtataagaactgtgagctggacaagaaccag
cggcagtgtgtagaatacgctctgaaggctcgccccctgcgaaggtacatccctaaaaac
aagtaccagtacaaagtttggtatgtggtaaactccacatattttgaatacctcattttc
atcctcatcatgctgaataccatctgcctggccatgcagcactatggccagagctgcctc
ttcaaggaagcaatgaacattctcaacatgctgttcaccggcctcttcactgtcgagatg
gtcttgaaattaattgccttcaaacccaagggttactttagtgatccttggaatgttttt
gacttcctcatcgtaattggcagcattatagacgtcattctcagtgaaactaatccagct
gaacatacccaatgctcttcctctatgaacgcagaggaaaactctcgcatctcaatcacc
tttttccgactcttccgtgtgatgcgtctggtgaagctcttgagccgaggggagggcatc
cgcacgctgctttggaccttcatcaagtccttccaggctctcccctatgtggctctttta
atagtgatgctgttttttatctatgctgtgatcgggatgcaggtgtttggtaaaattgcc
ttgaatgataccacagaaatcaacaggaacaacaactttcagactttccctcaagcagtg
ctgctacttttcaggtgtgctactggtgaagcatggcaggaaatcatgctggcatgcctc
cctgataagaaatgtgactctgattccttggaacaaaacaactctaccgaagatgagtat
tcctgtggaagcagctttgccatcttttatttcattagtttctacatgctttgtgccttt
ctaattattaatctttttgttgctgttatcatggataactttgactacctgacacgggac
tggtcaattcttggacctcatcatctggatgagtttaaacgtatttgggctgaatatgat
cctgaagctaagggacgtatcaaacacttagatgtggtaacacttctgcgtcggatacag
cctccactgggctttggcaagctctgccctcaccgagtggcttgtaaacgccttgtctcc
atgaatatgccactgaatagtgatgggactgtcatgtttaatgccactctttttgcactg
gtcagaacagcactgaggattaaaacagaaggtaacttggagcaagccaatgaagagttg
cgtgcaatcattaagaaaatctggaagcgtaccagtatgaagcttctggatcaggttgtc
cccccagcaggtgatgatgaggtaacggttggaaagttctatgccacattcctaatccaa
gagtatttccggaaattcaagaaacgcaaagaacagggccttgttggtaaaccttcacag
cgaaatgcactttctctccaggctggtctgcgtacattacatgacattgggccagaaatc
cgacgggctatctctggagacttgactgctgaagaagagttagacaaggccatgaaagaa
gctgtttctgctgcctctgaggatgatatcttcagaagagctggtggattgtttggaaat
catgtcagctactaccagagcgatggaagaagttcgtttcctcagacattcaccactcaa
cgccctttgcacatcaacaaatctagcaacaaccagggagacacggaatccccctcccat
gagaagcttgtggattccaccttcactccaagcagctactcctcatcaggctctaatgct
aacatcaacaatgccaacaacactgccttgagccgcttccccagcccaccaaggtacccc
agcactgtcagcactgtagaaggccacagtactcctttgtcaccctctgcacggatccgg
gaacccccatggaagcttggttgcagaaggtcctgttctagagacagccaggtggctatt
gtttgtgaggaggagccttctcaggaggaagaaacatatgatgagcgactgaatgaagaa
gttgaatactgtagtgagccaagcttgctgtctactgaaatgctctcataccaagatgat
gaacatagacagctaactcctcctgaaaactgcaaaggggaagataccagacactctcca
aagagtgggttcctgcgttccgcatcactaaatcgaagagcatcctttcacctggaatgc
ctaaaaagacagaaaaatccaagtgcggtaggcccacaaaagacagtactacctttgcat
ctggtacatcaacaggcactagcagttgcaggtatgagtcctcttcttcaaagatgccat
tctcctgtaagagcctctcgatcatgtaccacacccttcactacaccatgtacacaaagc
tggccgcagcagcccattaaaaccttacagcttgatggagaggaatctaatgagaaactc
aatagtagcttcccatcagtacagtgcagctccttatattctgatggcactaactctggc
agcactcgaaaagtgaggccagtctccctcacagttcccagccagactacagagtgtggg
aggcaatttcacggcagcgctaacagccttgtagaagcggtcttgatttctgaaggactg
gtgcagtttgctcaagatccaaagttcattgaagttacgacccaagagttagcggatgcc
tgtgaattgacgatagaagagatggagaatgctgcagacaatattctcaatggtaacagc
aagccaagccccaatggcaaactcttgccttttgttaactgcagggactcagggcaggac
tgtatgggagaggaagaagcagcagcccagaacccagattgtaaaaaaagtcaagaggag
tctaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system