KEGG   Gekko japonicus: 107120887Help
Entry
107120887         CDS       T04299                                 

Gene name
SMARCC2
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gja03021]
    107120887 (SMARCC2)
   03036 Chromosome and associated proteins [BR:gja03036]
    107120887 (SMARCC2)
Transcription machinery [BR:gja03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107120887 (SMARCC2)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    107120887 (SMARCC2)
   PBAF complex
    107120887 (SMARCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_3 SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 BRCT_2 Chromo
Motif
Other DBs
NCBI-GeneID: 107120887
NCBI-ProteinID: XP_015279135
LinkDB All DBs
Position
Un
AA seq 1029 aa AA seqDB search
MAVRKKDGGPNVKYYEASDTVSQFDSARVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGKHVSNAPLTKLPIKCFLDFKAGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPNIYLHPDTDPKLQAKLKDIIKRHQGTVTEDKNNASHIVFP
VPGSLEEDCTHTEEWVRPIMKRDKQVLLHWGYYPDSYDTWIAASEIEAPVEDAPTAEKPR
KVHAKWILDTDTFNEWMNEEDYEVNDEKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGN
YKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEV
ILPKTVNTKKDSESAPVKGGTMTDLDEPEDESMETAGKDEEENNAGNKGEQTKNPDLHED
NVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRL
NPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLA
DTPSGLVPLQPKTPQGRQSDSDTKAGRKTKEIEDLVTETVKGKPEMQTTASQQMLNFPDK
SKEKPPDMQNFGLRTDMYTKKNAPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVS
EHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVV
DPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTT
SDELERIGEGGERGVFRASTREAPSLDLAQCAVGTKKGAETQETRAGLASGLELTLNRLA
QEESCTDESRAEPQPSEEKKEVKEPREGPLEEEVKEKLGEGPRKEEDKNKEADGEKEMDK
NDGDPMADGDKEKEPKDGQEEGPKDLAEIESERKTKVERDIGEGNLSTAAAAALAAAAVK
AKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREAPRRCRVNTGMAHD
SSDIVQAAD
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcggaagaaggacggcggccccaacgtcaaatactacgaggcctcagacacc
gttagccagttcgacagcgcgcgcgtctggctggggaagaactacaagaagtatatccaa
gcagaaccacccaccaataagtcattgtccagcctagtggtgcagctgttgcagttccaa
gaggaagtgtttggaaaacatgtcagcaatgcacctctcacaaagttaccgatcaaatgc
ttcttagatttcaaagctggtggtgctctttgtcacatcctcgcagcagcctataaattc
aagagtgaccaaggatggcggcgtttcgatttccagaatccatcacggatggatcgcaat
gtggagatgttcatgaccattgaaaaatcattagtgcagaacaattgcctctcccggcct
aacatctatttacatccagacaccgaccctaaattgcaggccaaactaaaagacatcatc
aaacggcaccagggaacagtaacagaagataagaataatgcttcccatattgtctttcct
gttcctggtagcctggaggaagattgtacacatacagaagagtgggttcggcccatcatg
aagagagacaaacaggttcttctgcactggggctactaccctgacagctatgacacttgg
atcgcagcaagtgaaattgaagcccctgtggaggatgccccaacagctgagaagccccga
aaggttcatgccaagtggatccttgacacagataccttcaacgagtggatgaatgaagaa
gactatgaggtaaacgatgagaagaatcccgtctcccgtaggaagaaaatctctgcaaag
actctcacagatgaggttaacagccctgactcagaccgacgagacaagaaagggggaaac
tataagaaaaggaagcgttctccctctccttcacctactccagaggctaagaagaagaat
gccaagaaagggccttccactccctataccaaatcgaagcggggccaccgggaagaggag
caagaagacctcacaaaggacatggatgagccttcacctgtccccaatgttgaagaagtc
atactaccaaaaacagtgaacaccaagaaagactctgaatctgctcctgtgaaggggggc
actatgactgatttggacgaaccagaggatgagagcatggagactgcgggaaaggatgaa
gaagagaacaatgctggcaacaaaggagagcagacaaagaaccctgaccttcatgaagac
aacgtgacagaacagactcatcacattatcattcccagttatgcagcctggtttgactat
aacagtgtccatgccattgagcgaagagccctcccggaatttttcaatggcaagaacaag
tccaagactcctgaaatctacttggcataccgcaatttcatgattgacacataccggctc
aatccacaggagtacctaacctcaactgcttgtcgccggaatctggctggagatgtctgt
gccatcatgagggtccatgccttcctagaacagtggggactcattaattatcaagtggat
gctgagagccggccgacacccatgggaccaccacccacctctcatttccatgttctggcc
gacactccttcagggttggtgccactgcagcccaagacgccccagggtcgtcagagcgac
agtgacaccaaggcgggtcggaaaaccaaggaaattgaggaccttgtcacagagacggtg
aaagggaaacctgaaatgcagaccacagcttcccagcagatgttgaacttccctgataag
agcaaggagaagcctccagacatgcaaaactttgggctgcgtactgacatgtacaccaag
aagaatgctccctccaagagcaaagctgctgccagcgccactcgggagtggaccgagcag
gagacgctgctgctgctggaggccttggagatgtacaaggatgactggaacaaggtttct
gagcatgttggcagccgcactcaggacgagtgcatcctacacttcctgcgtctccccatt
gaggacccttacctggaggactcggaggcctctcttgggcccctagcctaccagcccatc
cccttcagccagtcaggcaatcctgtcatgagcactgtggctttcctggcttcggttgtg
gacccccgtgtggcatctgcagcagccaagtcggccctagaggaattctccaagatgaag
gaagaggtgcctacagccttggttgaagctcacgtccgcaaggtggaggaagccgccaag
gtgacaggcaaggcagacccggcatttgggctggagagcagcggaattgcagggaccact
tccgatgagctggagagaataggtgaggggggcgagcggggcgtcttccgcgcttcaacc
cgtgaagcgccctcgttggaccttgcccagtgtgcggtggggactaagaagggtgccgag
acgcaagagaccagagccggcctggcttccggcctggagctcacactcaaccgcctggca
caggaagagagctgcacagatgagagtcgagcagaaccacagccatcagaagagaagaaa
gaggtgaaggagccaagagaaggacccctggaggaggaagtaaaagagaaactcggagag
gggcctaggaaagaagaagacaagaacaaagaggctgatggagagaaggaaatggacaag
aatgatggggaccccatggctgatggagacaaggagaaagagcccaaggatggccaggaa
gagggacccaaggatctggccgagattgagagtgaacgaaagaccaaggtggagagggac
attggtgaaggtaacctctccactgcagcagctgctgctctggctgctgcagcagtaaag
gcaaagcacttggcagcagtggaggagcgtaaaatcaagtccctggtggccttgctggta
gagacacagatgaagaaacttgagatcaagttgaggcactttgaggagctggagaccatc
atggatcgggagcgtgaggcaccaaggagatgcagggtgaacacaggcatggctcatgac
tcctctgatatcgtccaagcagcagactaa

DBGET integrated database retrieval system