KEGG   Gekko japonicus: 107121111Help
Entry
107121111         CDS       T04299                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
gja  Gekko japonicus
Pathway
gja00562  Inositol phosphate metabolism
gja01100  Metabolic pathways
gja04068  FoxO signaling pathway
gja04070  Phosphatidylinositol signaling system
gja04115  p53 signaling pathway
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04218  Cellular senescence
gja04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107121111
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107121111
   04070 Phosphatidylinositol signaling system
    107121111
   04150 mTOR signaling pathway
    107121111
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107121111
  09143 Cell growth and death
   04115 p53 signaling pathway
    107121111
   04218 Cellular senescence
    107121111
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107121111
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gja01009]
    107121111
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107121111
    3.1.3.48  protein-tyrosine-phosphatase
     107121111
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107121111
Protein phosphatases and associated proteins [BR:gja01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107121111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DUF3256
Motif
Other DBs
NCBI-GeneID: 107121111
NCBI-ProteinID: XP_015279460
LinkDB All DBs
Position
Un
AA seq 207 aa AA seqDB search
MMFETIPMFSGGTCNPHFVVYQLKVKIFTSSSGPTRRGDKYMYFEFPQPLPVCGDIKVEF
FHKQNKMLKKDKMFHFWVNTFFIPGPEENSDKVENGSLLGDQELDGIFSTERSDNDKEYL
ILTLTKNDLDKANKDKANRYFSPNFKVKLFFTKTVEEPSNAEASSSTSVTPDVSDNEPDH
YRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttgaaacaattccaatgttcagtggcggcacttgcaatcctcactttgtggtc
taccagcttaaggtaaagatattcacctcctcttcaggacccacaagacgtggagacaaa
tatatgtactttgagttccctcagccattaccagtttgtggcgacatcaaggtggaattc
ttccataaacaaaacaaaatgttgaaaaaggacaaaatgtttcatttctgggtaaataca
ttcttcataccaggaccggaagaaaattctgataaagtagaaaatggcagcctgcttgga
gatcaagaactagatggtattttcagcacagagcgttcagataatgacaaggaatatcta
atacttacactaacaaaaaatgatttagacaaggcgaataaagacaaggcaaatcgttac
ttctctccaaactttaaggtgaagctatttttcacaaaaacggtggaggagccgtcaaac
gcagaagcgagcagctcaacttcagtaacaccggacgttagtgataatgaacctgatcat
tataggtattctgacaccactgactctgatccagagaatgaaccttttgatgaagatcag
catacacagattacaaaagtctga

DBGET integrated database retrieval system