KEGG   Gekko japonicus: 107121241
Entry
107121241         CDS       T04299                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107121241 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107121241 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gja04052]
    107121241 (KITLG)
Cytokines and growth factors [BR:gja04052]
 Growth factors
  Growth factors (RTK binding)
   107121241 (KITLG)
SSDB
Motif
Pfam: SCF Peptidase_S10
Other DBs
NCBI-GeneID: 107121241
NCBI-ProteinID: XP_015279612
LinkDB
Position
Un
AA seq 280 aa
MKKAQTWIITCFYLQLLLFSPLVKAQNPCGNPVTDDVNDIKKLVDNLPNDYRITLKYVEK
MDSLPNHCWLHLMVPELTNSLNNLLQKFNEISDMSDVLSNYSIINNLTRIIYDIMACLSP
KNKNFIKQSDYLYKEVQLFPEDFFEHFYNTIEVYKAVANKPEQNECVLLSTTETPRNESR
VTKPFLLPPVAASSLRNESSGYNSNKEALGLFSSPSLQGISITLTSLVTLFVGFILGALC
WKRTTRRHTLESDRTAQSDVCQEDNEISMLQQKEKSLLQV
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttatcttcaactgctcctattcagt
cctcttgtcaaagctcaaaatccctgcgggaatcctgtgacagatgatgtgaatgacatt
aaaaaactggttgacaatcttccaaatgattataggataacccttaaatatgtcgagaag
atggacagtctgcctaatcactgttggttgcatttgatggtccctgaattgacaaacagt
ctgaataatcttctccaaaaatttaacgaaatttcagatatgtcagatgtcttaagtaat
tattcaattataaataatctcacaaggatcatctatgatataatggcatgtctgtctcct
aaaaataagaattttataaaacaaagtgattatctttataaagaagttcaactcttccca
gaagacttttttgagcatttttataacaccattgaagtttacaaagctgttgcaaataaa
ccagaacagaatgagtgcgttctgctttcaactacggaaacaccccgaaatgagtcaaga
gtcaccaagccatttttgttacctcccgttgctgctagctctcttaggaacgagagcagt
ggttataacagcaacaaggaggcactgggtttgttcagcagccccagcttacaaggaatt
agtataacactgacatcattggtgactctttttgttggctttattttgggagctctatgc
tggaagagaacaactcgcagacacacactagagagtgaccgcactgcacaatctgatgtc
tgccaagaggataatgagataagtatgttgcagcagaaagaaaagtcgcttctacaagtg
tag

DBGET integrated database retrieval system